Le choix d'une selle et de son équipement est important pour vous comme pour votre monture car cela conditionne votre plaisir à cheval et également le confort de votre cheval. Selles de dressage, selle de randonnées, selles d'obstacle, ... le choix est large, sans oublier l'équipement de celles-ci avec les étrivières, étriers, sangles, ...
| Load Time | 205.457 ms |
| Querying Time | 102 ms |
| Queries | 281 |
| Memory Peak Usage | 8.3 Mb |
| Included Files | 934 files - 10.63 Mb |
| PrestaShop Cache | - Mb |
| Global vars | 0.61 Mb |
| PrestaShop Version | 8.2.1 |
| PHP Version | 8.3.27 |
| MySQL Version | 10.5.27-MariaDB |
| Memory Limit | 1024M |
| Max Execution Time | 300s |
| Smarty Cache | enabled |
| Smarty Compilation | never recompile |
| Time | Cumulated Time | Memory Usage | Memory Peak Usage | |
|---|---|---|---|---|
| config | 1.659 ms | 1.659 ms | 2.30 Mb | 2.7 Mb |
| __construct | 0.012 ms | 1.671 ms | - Mb | 2.7 Mb |
| init | 19.869 ms | 21.540 ms | 0.70 Mb | 3.3 Mb |
| checkAccess | 0.001 ms | 21.541 ms | - Mb | 3.3 Mb |
| setMedia | 5.912 ms | 27.453 ms | 0.20 Mb | 3.3 Mb |
| postProcess | 0.001 ms | 27.454 ms | - Mb | 3.3 Mb |
| initHeader | 0.001 ms | 27.455 ms | - Mb | 3.3 Mb |
| initContent | 137.099 ms | 164.554 ms | 3.06 Mb | 6.3 Mb |
| initFooter | 0.002 ms | 164.556 ms | - Mb | 6.3 Mb |
| display | 40.901 ms | 205.457 ms | 1.55 Mb | 8.3 Mb |
| Hook | Time | Memory Usage |
|---|---|---|
| DisplayHeader | 8.646 ms | 0.10 Mb |
| Header | 5.518 ms | 0.02 Mb |
| displayBeforeBodyClosingTag | 4.898 ms | 0.08 Mb |
| displayLeftColumn | 3.628 ms | 0.18 Mb |
| DisplayBeforeBodyClosingTag | 1.478 ms | 0.05 Mb |
| displayMainMenu | 1.459 ms | 0.22 Mb |
| renderWidget | 1.413 ms | 0.05 Mb |
| displayFooter | 1.372 ms | 0.10 Mb |
| displayNav2 | 1.346 ms | 0.10 Mb |
| ProductSearchProvider | 1.340 ms | - Mb |
| displayCategoryElementor | 1.063 ms | 0.08 Mb |
| displayProductListFunctionalButtons | 0.890 ms | - Mb |
| DisplayNavFullWidth | 0.709 ms | - Mb |
| DisplayFooter | 0.685 ms | 0.03 Mb |
| DisplayBanner | 0.678 ms | 0.02 Mb |
| DisplayFooterCategory | 0.614 ms | 0.02 Mb |
| DisplayLeftColumn | 0.403 ms | 0.03 Mb |
| displayAfterBreadcrumb | 0.356 ms | 0.04 Mb |
| IsJustElementor | 0.195 ms | 0.02 Mb |
| ActionFrontControllerSetMedia | 0.073 ms | - Mb |
| ModuleRoutes | 0.007 ms | - Mb |
| ActionDispatcher | 0.006 ms | - Mb |
| ActionProductSearchAfter | 0.006 ms | - Mb |
| displayVerticalMenu | 0.005 ms | - Mb |
| 24 hook(s) | 36.787 ms | 1.15 Mb |
| Module | Time | Memory Usage |
|---|---|---|
| ph_simpleblog | 5.815 ms | 0.12 Mb |
| iqitthemeeditor | 0.967 ms | 0.07 Mb |
| mondialrelay | 0.607 ms | 0.05 Mb |
| ps_emailalerts | 0.338 ms | 0.01 Mb |
| paybox | 4.147 ms | 0.13 Mb |
| paypal | 9.687 ms | 0.14 Mb |
| iqitcontactpage | 1.344 ms | 0.06 Mb |
| iqitcookielaw | 1.830 ms | 0.05 Mb |
| iqitelementor | 2.801 ms | 0.11 Mb |
| iqitmegamenu | 2.271 ms | 0.24 Mb |
| iqitreviews | 0.663 ms | 0.01 Mb |
| iqitsizecharts | 0.485 ms | 0.01 Mb |
| iqitwishlist | 6.122 ms | 0.10 Mb |
| ets_htmlbox | 5.883 ms | 0.12 Mb |
| ps_shoppingcart | 0.181 ms | 0.01 Mb |
| stripe_official | 1.880 ms | 0.11 Mb |
| sendinblue | 0.918 ms | 0.09 Mb |
| ps_facetedsearch | 3.234 ms | 0.05 Mb |
| ps_currencyselector | 0.657 ms | 0.07 Mb |
| iqitsearch | 1.675 ms | 0.05 Mb |
| ps_customersignin | 0.087 ms | - Mb |
| iqitproductsnav | 0.616 ms | 0.05 Mb |
| ps_categorytree | 3.734 ms | 0.19 Mb |
| ps_emailsubscription | 0.400 ms | 0.05 Mb |
| statsdata | 1.587 ms | 0.05 Mb |
| 25 module(s) | 57.929 ms | 1.91 Mb |
| # | Query | Time (ms) | Rows | Filesort | Group By | Location |
|---|---|---|---|---|---|---|
| 101 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 24 ORDER BY agl.`name` ASC, a.`position` ASC |
1.360 ms | 1394 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 2 | SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop FROM `prstshp_configuration` c LEFT JOIN `prstshp_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`) |
1.169 ms | 1237 | /classes/Configuration.php:180 | ||
| 266 | SELECT SQL_NO_CACHE c.*, cl.* FROM `prstshp_category` c INNER JOIN prstshp_category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `prstshp_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 LEFT JOIN `prstshp_category_group` cg ON c.`id_category` = cg.`id_category` RIGHT JOIN `prstshp_category` c2 ON c2.`id_category` = 465 AND c.`nleft` >= c2.`nleft` AND c.`nright` <= c2.`nright` WHERE 1 AND c.`level_depth` <= 7 AND `id_lang` = 1 AND c.`active` = 1 AND cg.`id_group` IN (1) GROUP BY c.`id_category` ORDER BY c.`level_depth` ASC, category_shop.`position` ASC |
1.165 ms | 95 | Yes | Yes | /classes/Category.php:785 |
| 106 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=28)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
1.139 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 100 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=22)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
1.044 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 104 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=27)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
1.022 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 92 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=15)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
1.021 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 74 | SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND cg.id_group='1' AND c.level_depth<=4 AND c.nleft>172 AND c.nright<193 GROUP BY cp.id_category |
0.999 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 94 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=16)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.998 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 102 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=24)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.989 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 122 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) WHERE ((a.id_attribute_group=52)) GROUP BY pac.id_attribute |
0.941 ms | 2268 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 98 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=21)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.912 ms | 96 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 138 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=78)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.907 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 76 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=5)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.907 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 136 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=77)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.896 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 134 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=73)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.890 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 140 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=87)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.883 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 88 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=12)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.881 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 150 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=101)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.875 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 154 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=105)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.859 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 108 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=29)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.854 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 82 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=8)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.851 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 80 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=7)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.850 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 124 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=55)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.837 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 142 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=92)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.834 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 156 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=106)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.834 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 199 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook` UNION SELECT `id_hook`, ha.`alias` as name FROM `prstshp_hook_alias` ha INNER JOIN `prstshp_hook` h ON ha.name = h.name |
0.834 ms | 0 | /classes/Hook.php:1348 | ||
| 90 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=14)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.833 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 184 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=144)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.833 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 174 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=134)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.831 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 152 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=104)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.830 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 78 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=6)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.825 ms | 96 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 146 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=98)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.823 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 172 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=133)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.823 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 144 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=97)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.823 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 132 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=64)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.822 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 116 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=36)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.821 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 120 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=46)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.819 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 148 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=100)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.818 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 110 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=30)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.817 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 118 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=43)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.815 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 126 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=56)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.812 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 182 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=139)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.812 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 112 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=31)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.811 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 162 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=110)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.809 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 180 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=138)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.809 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 166 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=117)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.801 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 96 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=18)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.800 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 128 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=58)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.797 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 130 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=62)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.795 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 164 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=116)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.794 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 186 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=148)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.793 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 170 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=122)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.791 ms | 144 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 84 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=9)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.788 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 114 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=35)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.786 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 158 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=107)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.779 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 86 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=10)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.769 ms | 96 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 160 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=108)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.768 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 168 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=120)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.760 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 178 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=137)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.758 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 176 | SELECT SQL_NO_CACHE pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_1 ON (pa.id_product_attribute = pac_1.id_product_attribute) WHERE ((a.id_attribute_group=136)) AND ((pac_1.id_attribute IN (1252, 1253, 1255, 1753))) GROUP BY pac.id_attribute |
0.756 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 71 | SELECT SQL_NO_CACHE p.id_product, p.id_product_attribute FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1 AND sa.id_shop_group = 0 ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (1252, 1253, 1255, 1753))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=172 AND c.nright<=193 GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC |
0.720 ms | 48 | Yes | /modules/ps_facetedsearch/src/Adapter/MySQL.php:85 | |
| 13 | SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module FROM `prstshp_module` m INNER JOIN prstshp_module_shop module_shop ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1) INNER JOIN `prstshp_hook_module` `hm` ON hm.`id_module` = m.`id_module` INNER JOIN `prstshp_hook` `h` ON hm.`id_hook` = h.`id_hook` LEFT JOIN `prstshp_module_group` `mg` ON mg.`id_module` = m.`id_module` WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND mg.`id_group` IN (1)) GROUP BY hm.id_hook, hm.id_module ORDER BY hm.`position` |
0.714 ms | 153 | Yes | Yes | /classes/Hook.php:1289 |
| 39 | SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description` FROM `prstshp_category` c INNER JOIN prstshp_category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) LEFT JOIN `prstshp_category_group` cg ON (cg.`id_category` = c.`id_category`) WHERE `id_parent` = 465 AND `active` = 1 AND cg.`id_group` =1 GROUP BY c.`id_category` ORDER BY `level_depth` ASC, category_shop.`position` ASC |
0.709 ms | 10 | Yes | Yes | /classes/Category.php:916 |
| 200 | SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active FROM `prstshp_hook_module` hm STRAIGHT_JOIN `prstshp_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1) STRAIGHT_JOIN `prstshp_module` as m ON (m.id_module = hm.id_module) ORDER BY hm.position |
0.651 ms | 361 | /classes/Hook.php:455 | ||
| 187 | REPLACE INTO prstshp_layered_filter_block (hash, data) VALUES ("02ffc1b122a69bee139dd2e483dd9f0d", "a:1:{s:7:\"filters\";a:2:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:1:{i:475;a:2:{s:4:\"name\";s:25:\"SSE Accessoires de selles\";s:3:\"nbr\";s:1:\"2\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:10:{s:9:\"type_lite\";s:18:\"id_attribute_group\";s:4:\"type\";s:18:\"id_attribute_group\";s:6:\"id_key\";s:2:\"52\";s:4:\"name\";s:15:\"Arcade d\'arçon\";s:14:\"is_color_group\";b:0;s:6:\"values\";a:14:{i:1250;a:4:{s:4:\"name\";s:20:\"Garrot étroit jaune\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1251;a:4:{s:4:\"name\";s:27:\"garrot médium/étroit vert\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1252;a:5:{s:4:\"name\";s:19:\"garrot médium noir\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1253;a:5:{s:4:\"name\";s:25:\"garrot médium/large bleu\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1254;a:4:{s:4:\"name\";s:18:\"garrot large rouge\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1255;a:5:{s:4:\"name\";s:21:\"garrot ex-large blanc\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1277;a:4:{s:4:\"name\";s:9:\"Blanc / S\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1279;a:4:{s:4:\"name\";s:8:\"Bleu / M\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1281;a:4:{s:4:\"name\";s:7:\"Vert /L\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1282;a:4:{s:4:\"name\";s:10:\"Jaune / XL\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1753;a:5:{s:4:\"name\";s:8:\"Rouge /S\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1754;a:4:{s:4:\"name\";s:8:\"Rouge /M\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1755;a:4:{s:4:\"name\";s:7:\"Noir /M\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1756;a:4:{s:4:\"name\";s:7:\"Noir/ L\";s:3:\"nbr\";s:1:\"1\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}") |
0.644 ms | 1 | /modules/ps_facetedsearch/src/Filters/Block.php:209 | ||
| 280 | INSERT INTO `prstshp_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('39335540', '', 'sellerie-sylvie-equitation.com/465-sse-selles-equipements?productListView=grid&q=Arcade+d%27ar%C3%A7on-garrot+m%C3%A9dium+noir-garrot+m%C3%A9dium%5C%2Flarge+bleu-garrot+ex%5C-large+blanc-Rouge+%5C%2FS', '', '2025-11-06 01:55:27') |
0.530 ms | 1 | /classes/ObjectModel.php:622 | ||
| 79 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 7 ORDER BY agl.`name` ASC, a.`position` ASC |
0.488 ms | 83 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 73 | SELECT SQL_NO_CACHE c.`id_category`, cl.`name` FROM `prstshp_category` c INNER JOIN prstshp_category_shop category_shop ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1) LEFT JOIN `prstshp_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 WHERE 1 AND `id_lang` = 1 AND c.`active` = 1 ORDER BY c.nleft, c.position |
0.473 ms | 185 | Yes | /classes/Category.php:710 | |
| 0 | SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main FROM prstshp_shop_url su LEFT JOIN prstshp_shop s ON (s.id_shop = su.id_shop) WHERE (su.domain = 'sellerie-sylvie-equitation.com' OR su.domain_ssl = 'sellerie-sylvie-equitation.com') AND s.active = 1 AND s.deleted = 0 ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC |
0.445 ms | 1 | Yes | /classes/shop/Shop.php:1364 | |
| 67 | SELECT SQL_NO_CACHE ag.id_attribute_group, agl.public_name as attribute_group_name, is_color_group, IF(liaglv.`url_name` IS NULL OR liaglv.`url_name` = "", NULL, liaglv.`url_name`) AS url_name, IF(liaglv.`meta_title` IS NULL OR liaglv.`meta_title` = "", NULL, liaglv.`meta_title`) AS meta_title, IFNULL(liag.indexable, TRUE) AS indexable FROM `prstshp_attribute_group` ag INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) LEFT JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) LEFT JOIN `prstshp_layered_indexable_attribute_group` liag ON (ag.`id_attribute_group` = liag.`id_attribute_group`) LEFT JOIN `prstshp_layered_indexable_attribute_group_lang_value` AS liaglv ON (ag.`id_attribute_group` = liaglv.`id_attribute_group` AND agl.`id_lang` = 1) GROUP BY ag.id_attribute_group ORDER BY ag.`position` ASC |
0.439 ms | 81 | Yes | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:122 |
| 99 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 22 ORDER BY agl.`name` ASC, a.`position` ASC |
0.425 ms | 38 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 72 | SELECT SQL_NO_CACHE data FROM prstshp_layered_filter_block WHERE hash="02ffc1b122a69bee139dd2e483dd9f0d" LIMIT 1 |
0.414 ms | 1 | /modules/ps_facetedsearch/src/Filters/Block.php:185 | ||
| 93 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 16 ORDER BY agl.`name` ASC, a.`position` ASC |
0.407 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 87 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 12 ORDER BY agl.`name` ASC, a.`position` ASC |
0.389 ms | 43 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 258 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `prstshp_product_attribute` pa INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (1633) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` ORDER BY a.`position` ASC; |
0.369 ms | 8 | Yes | Yes | /classes/Product.php:4513 |
| 188 | SELECT SQL_NO_CACHE p.*, ps.*, pl.*, sa.out_of_stock, IFNULL(sa.quantity, 0) as quantity, (DATEDIFF( p.`date_add`, DATE_SUB( '2025-11-06 00:00:00', INTERVAL 20 DAY ) ) > 0) as new FROM prstshp_product p LEFT JOIN prstshp_product_lang pl ON pl.id_product = p.id_product AND pl.id_shop = 1 AND pl.id_lang = 1 LEFT JOIN prstshp_stock_available sa ON sa.id_product = p.id_product AND sa.id_product_attribute = 0 AND sa.id_shop = 1 LEFT JOIN prstshp_product_shop ps ON ps.id_product = p.id_product AND ps.id_shop = 1 WHERE p.id_product IN (1633,1547) |
0.369 ms | 2 | /classes/ProductAssembler.php:95 | ||
| 97 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 21 ORDER BY agl.`name` ASC, a.`position` ASC |
0.346 ms | 2 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 15 | SELECT SQL_NO_CACHE `id_hook`, `name` FROM `prstshp_hook` |
0.340 ms | 1004 | /classes/Hook.php:1348 | ||
| 68 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 52 ORDER BY agl.`name` ASC, a.`position` ASC |
0.338 ms | 14 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 95 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 18 ORDER BY agl.`name` ASC, a.`position` ASC |
0.338 ms | 10 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 12 | SELECT SQL_NO_CACHE lower(name) as name FROM `prstshp_hook` h WHERE (h.active = 1) |
0.335 ms | 1004 | /classes/Hook.php:1388 | ||
| 66 | SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM prstshp_layered_category WHERE controller = 'category' AND id_category = 465 AND id_shop = 1 GROUP BY `type`, id_value ORDER BY position ASC |
0.335 ms | 57 | Yes | Yes | /modules/ps_facetedsearch/src/Filters/Provider.php:57 |
| 155 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 106 ORDER BY agl.`name` ASC, a.`position` ASC |
0.331 ms | 34 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 171 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 133 ORDER BY agl.`name` ASC, a.`position` ASC |
0.330 ms | 19 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 259 | SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by FROM `prstshp_product_attribute` pa INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`) JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`) JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`) WHERE pa.`id_product` IN (1547) AND ag.`is_color_group` = 1 GROUP BY pa.`id_product`, a.`id_attribute`, `group_by` ORDER BY a.`position` ASC; |
0.324 ms | 6 | Yes | Yes | /classes/Product.php:4513 |
| 89 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 14 ORDER BY agl.`name` ASC, a.`position` ASC |
0.320 ms | 5 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 103 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 27 ORDER BY agl.`name` ASC, a.`position` ASC |
0.317 ms | 20 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 208 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `prstshp_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 1633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 1633 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.316 ms | 0 | /classes/Cart.php:1430 | ||
| 210 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `prstshp_cart_product` cp WHERE cp.`id_product_attribute` = 22357 AND cp.`id_cart` = 0 AND cp.`id_product` = 1633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 22357 AND cp.`id_cart` = 0 AND p.`id_product_item` = 1633 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.315 ms | 0 | /classes/Cart.php:1430 | ||
| 107 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 29 ORDER BY agl.`name` ASC, a.`position` ASC |
0.306 ms | 10 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 169 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 122 ORDER BY agl.`name` ASC, a.`position` ASC |
0.304 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 105 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 28 ORDER BY agl.`name` ASC, a.`position` ASC |
0.303 ms | 5 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 227 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `prstshp_cart_product` cp WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND cp.`id_product` = 1547 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 0 AND cp.`id_cart` = 0 AND p.`id_product_item` = 1547 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.301 ms | 0 | /classes/Cart.php:1430 | ||
| 1 | SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri FROM prstshp_shop_group gs LEFT JOIN prstshp_shop s ON s.id_shop_group = gs.id_shop_group LEFT JOIN prstshp_shop_url su ON s.id_shop = su.id_shop AND su.main = 1 WHERE s.deleted = 0 AND gs.deleted = 0 ORDER BY gs.name, s.name |
0.300 ms | 1 | Yes | /classes/shop/Shop.php:715 | |
| 183 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 144 ORDER BY agl.`name` ASC, a.`position` ASC |
0.297 ms | 18 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 145 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 98 ORDER BY agl.`name` ASC, a.`position` ASC |
0.296 ms | 13 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 149 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 101 ORDER BY agl.`name` ASC, a.`position` ASC |
0.295 ms | 19 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 153 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 105 ORDER BY agl.`name` ASC, a.`position` ASC |
0.295 ms | 13 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 151 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 104 ORDER BY agl.`name` ASC, a.`position` ASC |
0.294 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 109 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 30 ORDER BY agl.`name` ASC, a.`position` ASC |
0.293 ms | 11 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 159 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 108 ORDER BY agl.`name` ASC, a.`position` ASC |
0.293 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 75 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 5 ORDER BY agl.`name` ASC, a.`position` ASC |
0.292 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 179 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 138 ORDER BY agl.`name` ASC, a.`position` ASC |
0.292 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 135 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 77 ORDER BY agl.`name` ASC, a.`position` ASC |
0.290 ms | 15 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 119 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 46 ORDER BY agl.`name` ASC, a.`position` ASC |
0.288 ms | 13 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 143 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 97 ORDER BY agl.`name` ASC, a.`position` ASC |
0.288 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 175 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 136 ORDER BY agl.`name` ASC, a.`position` ASC |
0.288 ms | 14 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 83 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 9 ORDER BY agl.`name` ASC, a.`position` ASC |
0.286 ms | 14 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 133 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 73 ORDER BY agl.`name` ASC, a.`position` ASC |
0.286 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 147 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 100 ORDER BY agl.`name` ASC, a.`position` ASC |
0.286 ms | 5 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 185 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 148 ORDER BY agl.`name` ASC, a.`position` ASC |
0.285 ms | 10 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 137 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 78 ORDER BY agl.`name` ASC, a.`position` ASC |
0.282 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 129 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 62 ORDER BY agl.`name` ASC, a.`position` ASC |
0.281 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 213 | SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`, pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`, pal.`available_now`, pal.`available_later` FROM `prstshp_attribute` a LEFT JOIN `prstshp_attribute_lang` al ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1) LEFT JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_attribute` = a.`id_attribute`) LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product_attribute` = pac.`id_product_attribute`) INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_lang` pal ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1) LEFT JOIN `prstshp_attribute_group_lang` agl ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) WHERE pa.`id_product` = 1633 AND pac.`id_product_attribute` = 22357 AND agl.`id_lang` = 1 |
0.281 ms | 1 | /classes/Product.php:7517 | ||
| 115 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 36 ORDER BY agl.`name` ASC, a.`position` ASC |
0.280 ms | 8 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 139 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 87 ORDER BY agl.`name` ASC, a.`position` ASC |
0.279 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 85 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 10 ORDER BY agl.`name` ASC, a.`position` ASC |
0.276 ms | 2 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 165 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 117 ORDER BY agl.`name` ASC, a.`position` ASC |
0.276 ms | 10 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 229 | SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity, COALESCE(SUM(first_level_quantity), 0) as quantity FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity FROM `prstshp_cart_product` cp WHERE cp.`id_product_attribute` = 20705 AND cp.`id_cart` = 0 AND cp.`id_product` = 1547 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product` WHERE cp.`id_product_attribute` = 20705 AND cp.`id_cart` = 0 AND p.`id_product_item` = 1547 AND (pr.`pack_stock_type` IN (1,2) OR ( pr.`pack_stock_type` = 3 AND 0 = 1 ))) as q LIMIT 1 |
0.275 ms | 0 | /classes/Cart.php:1430 | ||
| 157 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 107 ORDER BY agl.`name` ASC, a.`position` ASC |
0.274 ms | 10 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 91 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 15 ORDER BY agl.`name` ASC, a.`position` ASC |
0.273 ms | 9 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 141 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 92 ORDER BY agl.`name` ASC, a.`position` ASC |
0.272 ms | 8 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 121 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 52 ORDER BY agl.`name` ASC, a.`position` ASC |
0.271 ms | 14 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 173 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 134 ORDER BY agl.`name` ASC, a.`position` ASC |
0.270 ms | 7 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 163 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 116 ORDER BY agl.`name` ASC, a.`position` ASC |
0.269 ms | 5 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 77 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 6 ORDER BY agl.`name` ASC, a.`position` ASC |
0.269 ms | 2 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 181 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 139 ORDER BY agl.`name` ASC, a.`position` ASC |
0.268 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 123 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 55 ORDER BY agl.`name` ASC, a.`position` ASC |
0.268 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 177 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 137 ORDER BY agl.`name` ASC, a.`position` ASC |
0.265 ms | 5 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 19 | SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang FROM `prstshp_meta` m LEFT JOIN `prstshp_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 ) ORDER BY LENGTH(ml.url_rewrite) DESC |
0.263 ms | 53 | Yes | /classes/Dispatcher.php:654 | |
| 127 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 58 ORDER BY agl.`name` ASC, a.`position` ASC |
0.263 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 167 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 120 ORDER BY agl.`name` ASC, a.`position` ASC |
0.261 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 113 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 35 ORDER BY agl.`name` ASC, a.`position` ASC |
0.261 ms | 7 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 161 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 110 ORDER BY agl.`name` ASC, a.`position` ASC |
0.259 ms | 3 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 81 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 8 ORDER BY agl.`name` ASC, a.`position` ASC |
0.258 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 111 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 31 ORDER BY agl.`name` ASC, a.`position` ASC |
0.255 ms | 6 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 238 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `prstshp_image` i INNER JOIN prstshp_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1) WHERE i.`id_product` = 1547 ORDER BY `position` |
0.255 ms | 4 | Yes | /classes/Product.php:3539 | |
| 232 | SELECT SQL_NO_CACHE a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`, pa.`reference`, pa.`ean13`, pa.`isbn`, pa.`upc`, pa.`mpn`, pal.`available_now`, pal.`available_later` FROM `prstshp_attribute` a LEFT JOIN `prstshp_attribute_lang` al ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = 1) LEFT JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_attribute` = a.`id_attribute`) LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product_attribute` = pac.`id_product_attribute`) INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_lang` pal ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = 1) LEFT JOIN `prstshp_attribute_group_lang` agl ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) WHERE pa.`id_product` = 1547 AND pac.`id_product_attribute` = 20705 AND agl.`id_lang` = 1 |
0.252 ms | 1 | /classes/Product.php:7517 | ||
| 244 | SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2025-11-06 00:00:00" AND date_to <= "2025-11-06 23:59:59") OR (date_from >= "2025-11-06 00:00:00" AND date_from <= "2025-11-06 23:59:59") OR (date_from < "2025-11-06 00:00:00" AND date_to > "2025-11-06 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.250 ms | 2 | /classes/CartRule.php:357 | ||
| 117 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 43 ORDER BY agl.`name` ASC, a.`position` ASC |
0.248 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 125 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 56 ORDER BY agl.`name` ASC, a.`position` ASC |
0.243 ms | 4 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 212 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM prstshp_feature_product pf LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1) LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1) LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1) INNER JOIN prstshp_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 1633 ORDER BY f.position ASC |
0.242 ms | 4 | Yes | /classes/Product.php:6013 | |
| 131 | SELECT SQL_NO_CACHE DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = 1) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1) INNER JOIN prstshp_attribute_group_shop attribute_group_shop ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = 1) INNER JOIN prstshp_attribute_shop attribute_shop ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = 1) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = 1) WHERE ag.id_attribute_group = 64 ORDER BY agl.`name` ASC, a.`position` ASC |
0.241 ms | 1 | Yes | /modules/ps_facetedsearch/src/Filters/DataAccessor.php:77 | |
| 235 | SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position` FROM `prstshp_image` i INNER JOIN prstshp_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1) WHERE i.`id_product` = 1633 ORDER BY `position` |
0.241 ms | 1 | Yes | /classes/Product.php:3539 | |
| 201 | SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 17
AND tr.`id_state` IN (0, 0)
AND ('02200' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '02200')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.240 ms | 1 | /classes/tax/TaxRulesTaxManager.php:100 | ||
| 59 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 15 |
0.237 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 243 | SELECT SQL_NO_CACHE 1 FROM `prstshp_cart_rule` WHERE ((date_to >= "2025-11-06 00:00:00" AND date_to <= "2025-11-06 23:59:59") OR (date_from >= "2025-11-06 00:00:00" AND date_from <= "2025-11-06 23:59:59") OR (date_from < "2025-11-06 00:00:00" AND date_to > "2025-11-06 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1 |
0.236 ms | 2 | /classes/CartRule.php:357 | ||
| 231 | SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value FROM prstshp_feature_product pf LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1) LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1) LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1) INNER JOIN prstshp_feature_shop feature_shop ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) WHERE pf.id_product = 1547 ORDER BY f.position ASC |
0.229 ms | 4 | Yes | /classes/Product.php:6013 | |
| 267 | SELECT SQL_NO_CACHE DISTINCT c.* FROM `prstshp_category` c LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1) WHERE `level_depth` = 1 |
0.229 ms | 1 | /classes/Category.php:2239 | ||
| 237 | SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend` FROM `prstshp_product_attribute_image` pai LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`) LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`) WHERE pai.`id_product_attribute` IN (14526, 14528, 14530, 14531, 22357, 22358, 22359, 22360) AND il.`id_lang` = 1 ORDER by i.`position` |
0.228 ms | 8 | Yes | /classes/Product.php:2915 | |
| 271 | SELECT SQL_NO_CACHE c.*, cl.* FROM `prstshp_category` c LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 172 AND c.`nright` >= 193 AND c.`nleft` >= 2 AND c.`nright` <= 369 ORDER BY `nleft` DESC |
0.228 ms | 185 | Yes | /classes/Category.php:1594 | |
| 58 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a0 LEFT JOIN `prstshp_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`) WHERE (a0.`nleft` < 172) AND (a0.`nright` > 193) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1) ORDER BY a0.`nleft` asc |
0.225 ms | 185 | Yes | /classes/PrestaShopCollection.php:383 | |
| 192 | SELECT SQL_NO_CACHE * FROM `prstshp_product` a LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1 LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 1633) AND (b.`id_shop` = 1) LIMIT 1 |
0.224 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 17 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `prstshp_module` m LEFT JOIN `prstshp_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.223 ms | 64 | /classes/module/Module.php:341 | ||
| 219 | SELECT SQL_NO_CACHE * FROM `prstshp_product` a LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1 LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1 WHERE (a.`id_product` = 1547) AND (b.`id_shop` = 1) LIMIT 1 |
0.217 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 214 | SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 17
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.214 ms | 1 | /classes/tax/TaxRulesTaxManager.php:100 | ||
| 189 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `prstshp_image` i INNER JOIN prstshp_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 1633 AND image_shop.`cover` = 1 LIMIT 1 |
0.213 ms | 1 | /classes/Product.php:3570 | ||
| 223 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `prstshp_product` p INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 1547) |
0.210 ms | 6 | /classes/Product.php:3860 | ||
| 268 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1 |
0.210 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 197 | SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `prstshp_product` p INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1) LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1) WHERE (p.`id_product` = 1633) |
0.209 ms | 8 | /classes/Product.php:3860 | ||
| 11 | SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `prstshp_lang` l JOIN prstshp_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1) WHERE l.`active` = 1 LIMIT 1 |
0.207 ms | 1 | /classes/Language.php:1214 | ||
| 245 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 2 |
0.202 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 240 | SELECT SQL_NO_CACHE pai.`id_image`, pai.`id_product_attribute`, il.`legend` FROM `prstshp_product_attribute_image` pai LEFT JOIN `prstshp_image_lang` il ON (il.`id_image` = pai.`id_image`) LEFT JOIN `prstshp_image` i ON (i.`id_image` = pai.`id_image`) WHERE pai.`id_product_attribute` IN (20703, 20704, 20705, 20706, 20707, 20708) AND il.`id_lang` = 1 ORDER by i.`position` |
0.202 ms | 6 | Yes | /classes/Product.php:2915 | |
| 215 | SELECT SQL_NO_CACHE * FROM `prstshp_product_attribute` a LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1 WHERE (a.`id_product_attribute` = 22357) LIMIT 1 |
0.199 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 279 | SELECT SQL_NO_CACHE `id_guest` FROM `prstshp_connections` WHERE `id_guest` = 3446007 AND `date_add` > '2025-11-06 01:25:00' AND id_shop IN (1) ORDER BY `date_add` DESC LIMIT 1 |
0.199 ms | 1 | Yes | /classes/Connection.php:168 | |
| 230 | SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1547 AND pa.`id_product` = 1547 AND pa.`id_product_attribute` = 20705 LIMIT 1 |
0.197 ms | 1 | /classes/Product.php:1209 | ||
| 274 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 25 |
0.193 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 217 | SELECT SQL_NO_CACHE image_shop.`id_image` FROM `prstshp_image` i INNER JOIN prstshp_image_shop image_shop ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1) WHERE i.`id_product` = 1547 AND image_shop.`cover` = 1 LIMIT 1 |
0.191 ms | 4 | /classes/Product.php:3570 | ||
| 233 | SELECT SQL_NO_CACHE * FROM `prstshp_product_attribute` a LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = 1 WHERE (a.`id_product_attribute` = 20705) LIMIT 1 |
0.191 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 21 | SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop` FROM `prstshp_module` m LEFT JOIN `prstshp_module_shop` ms ON m.`id_module` = ms.`id_module` AND ms.`id_shop` = 1 |
0.190 ms | 64 | /classes/module/Module.php:341 | ||
| 196 | SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1633 LIMIT 1 |
0.189 ms | 1 | /classes/SpecificPrice.php:435 | ||
| 242 | SELECT SQL_NO_CACHE 1 FROM prstshp_cart_product cp INNER JOIN prstshp_product p ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1 |
0.187 ms | 1 | /classes/Cart.php:4249 | ||
| 22 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 465) AND (b.`id_shop` = 1) LIMIT 1 |
0.186 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 23 | SELECT SQL_NO_CACHE * FROM `prstshp_currency` c ORDER BY `iso_code` ASC |
0.183 ms | 1 | Yes | /classes/Currency.php:708 | |
| 221 | SELECT SQL_NO_CACHE product_attribute_shop.`price` FROM `prstshp_product_attribute` pa INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.`id_product_attribute` = 20705 LIMIT 1 |
0.182 ms | 1 | /classes/Combination.php:560 | ||
| 60 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 14 |
0.180 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 40 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 466) AND (b.`id_shop` = 1) LIMIT 1 |
0.174 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 211 | SELECT SQL_NO_CACHE pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE p.`id_product` = 1633 AND pa.`id_product` = 1633 AND pa.`id_product_attribute` = 22357 LIMIT 1 |
0.174 ms | 1 | /classes/Product.php:1209 | ||
| 234 | SELECT SQL_NO_CACHE * FROM `prstshp_product_attribute_lang` WHERE `id_product_attribute` = 20705 |
0.174 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 16 | SELECT SQL_NO_CACHE value FROM `prstshp_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1 |
0.173 ms | 1 | /classes/shop/Shop.php:1183 | ||
| 236 | SELECT SQL_NO_CACHE `id_product_attribute` FROM `prstshp_product_attribute` WHERE `id_product` = 1633 |
0.173 ms | 8 | /classes/Product.php:2899 | ||
| 41 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 467) AND (b.`id_shop` = 1) LIMIT 1 |
0.173 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 263 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 6 |
0.172 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 207 | SELECT SQL_NO_CACHE SUM(quantity) FROM `prstshp_stock_available` WHERE (id_product = 1633) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.170 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 206 | SELECT SQL_NO_CACHE tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 8
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('02200' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '02200')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC |
0.168 ms | 0 | /classes/tax/TaxRulesTaxManager.php:100 | ||
| 5 | SELECT SQL_NO_CACHE l.*, ls.`id_shop` FROM `prstshp_lang` l LEFT JOIN `prstshp_lang_shop` ls ON (l.id_lang = ls.id_lang) |
0.164 ms | 1 | /classes/Language.php:1080 | ||
| 62 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 17 |
0.164 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 4 | SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl FROM prstshp_shop s LEFT JOIN prstshp_shop_url su ON (s.id_shop = su.id_shop) WHERE s.id_shop = 1 AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1 |
0.163 ms | 1 | /classes/shop/Shop.php:214 | ||
| 265 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 13 AND `id_shop` = 1 LIMIT 1 |
0.163 ms | 1 | /classes/module/Module.php:2137 | ||
| 248 | SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `prstshp_currency` c LEFT JOIN prstshp_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1) WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1 |
0.157 ms | 1 | /classes/Currency.php:1134 | ||
| 24 | SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang` WHERE `locale` = 'fr-fr' OR `language_code` = 'fr-fr' LIMIT 1 |
0.157 ms | 1 | /classes/Language.php:880 | ||
| 26 | SELECT SQL_NO_CACHE * FROM `prstshp_currency` a LEFT JOIN `prstshp_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1 LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.157 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 42 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 468) AND (b.`id_shop` = 1) LIMIT 1 |
0.156 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 6 | SELECT SQL_NO_CACHE * FROM `prstshp_country` a LEFT JOIN `prstshp_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1 LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 8) LIMIT 1 |
0.155 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 46 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 472) AND (b.`id_shop` = 1) LIMIT 1 |
0.155 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 61 | SELECT SQL_NO_CACHE hbl.html,hb.style,hbl.id_lang FROM `prstshp_ets_hb_html_box` hb LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = 1) JOIN `prstshp_ets_hb_html_box_position` hbp ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`) WHERE hb.active = 1 AND hbp.`position` = 16 |
0.154 ms | 36 | /modules/ets_htmlbox/classes/HBHtmlbox.php:255 | ||
| 262 | SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c LEFT JOIN prstshp_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 465 AND s.id_shop = 1 LIMIT 1 |
0.154 ms | 1 | /modules/iqitelementor/src/IqitElementorCategory.php:87 | ||
| 228 | SELECT SQL_NO_CACHE SUM(quantity) FROM `prstshp_stock_available` WHERE (id_product = 1547) AND (id_product_attribute = 20705) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.153 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 27 | SELECT SQL_NO_CACHE `id_lang` FROM `prstshp_lang` WHERE `locale` = 'fr-fr' OR `language_code` = 'fr-fr' LIMIT 1 |
0.153 ms | 1 | /classes/Language.php:880 | ||
| 239 | SELECT SQL_NO_CACHE `id_product_attribute` FROM `prstshp_product_attribute` WHERE `id_product` = 1547 |
0.152 ms | 6 | /classes/Product.php:2899 | ||
| 195 | SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 0 LIMIT 1 |
0.152 ms | 1 | /classes/SpecificPrice.php:426 | ||
| 253 | SELECT SQL_NO_CACHE SUM(`quantity`) FROM `prstshp_cart_product` WHERE `id_cart` = 0 LIMIT 1 |
0.152 ms | 1 | /classes/Cart.php:1300 | ||
| 194 | SELECT SQL_NO_CACHE product_attribute_shop.`price` FROM `prstshp_product_attribute` pa INNER JOIN prstshp_product_attribute_shop product_attribute_shop ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1) WHERE pa.`id_product_attribute` = 22357 LIMIT 1 |
0.151 ms | 1 | /classes/Combination.php:560 | ||
| 269 | SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `prstshp_category` c LEFT JOIN `prstshp_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 465 LIMIT 1 |
0.151 ms | 1 | /classes/Category.php:1584 | ||
| 256 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitproductsnav" LIMIT 1 |
0.150 ms | 1 | /classes/module/Module.php:2664 | ||
| 10 | SELECT SQL_NO_CACHE domain, domain_ssl FROM prstshp_shop_url WHERE main = 1 AND id_shop = 1 LIMIT 1 |
0.149 ms | 1 | /classes/shop/ShopUrl.php:178 | ||
| 18 | SELECT SQL_NO_CACHE name, alias FROM `prstshp_hook_alias` |
0.149 ms | 88 | /classes/Hook.php:342 | ||
| 28 | SELECT SQL_NO_CACHE * FROM `prstshp_currency` a LEFT JOIN `prstshp_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1 WHERE (a.`id_currency` = 1) LIMIT 1 |
0.149 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 43 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 469) AND (b.`id_shop` = 1) LIMIT 1 |
0.149 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 52 | SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `products` = 1 ORDER BY `width` DESC, `height` DESC, `name`ASC |
0.149 ms | 8 | Yes | /classes/ImageType.php:109 | |
| 69 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 465) LIMIT 1 |
0.149 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 203 | SELECT SQL_NO_CACHE * FROM `prstshp_tax_lang` WHERE `id_tax` = 39 |
0.149 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 264 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_categorytree" LIMIT 1 |
0.148 ms | 1 | /classes/module/Module.php:2664 | ||
| 260 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitelementor" LIMIT 1 |
0.147 ms | 1 | /classes/module/Module.php:2664 | ||
| 190 | SELECT SQL_NO_CACHE cl.`link_rewrite` FROM `prstshp_category_lang` cl WHERE `id_lang` = 1 AND cl.id_shop = 1 AND cl.`id_category` = 475 LIMIT 1 |
0.146 ms | 1 | /classes/Category.php:1373 | ||
| 70 | SELECT SQL_NO_CACHE * FROM `prstshp_category_lang` WHERE `id_category` = 465 AND `id_shop` = 1 |
0.145 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 37 | SELECT SQL_NO_CACHE * FROM `prstshp_image_type` WHERE 1 AND `categories` = 1 ORDER BY `width` DESC, `height` DESC, `name`ASC |
0.144 ms | 8 | Yes | /classes/ImageType.php:109 | |
| 44 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 470) AND (b.`id_shop` = 1) LIMIT 1 |
0.144 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 47 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 473) AND (b.`id_shop` = 1) LIMIT 1 |
0.144 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 48 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 474) AND (b.`id_shop` = 1) LIMIT 1 |
0.144 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 216 | SELECT SQL_NO_CACHE * FROM `prstshp_product_attribute_lang` WHERE `id_product_attribute` = 22357 |
0.144 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 49 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 475) AND (b.`id_shop` = 1) LIMIT 1 |
0.143 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 209 | SELECT SQL_NO_CACHE SUM(quantity) FROM `prstshp_stock_available` WHERE (id_product = 1633) AND (id_product_attribute = 22357) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.143 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 226 | SELECT SQL_NO_CACHE SUM(quantity) FROM `prstshp_stock_available` WHERE (id_product = 1547) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1 |
0.143 ms | 1 | /classes/stock/StockAvailable.php:453 | ||
| 202 | SELECT SQL_NO_CACHE * FROM `prstshp_tax` a WHERE (a.`id_tax` = 39) LIMIT 1 |
0.143 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 241 | SELECT SQL_NO_CACHE c.id_elementor FROM prstshp_iqit_elementor_category c WHERE c.id_category = 465 LIMIT 1 |
0.143 ms | 1 | /modules/iqitelementor/src/IqitElementorCategory.php:87 | ||
| 8 | SELECT SQL_NO_CACHE * FROM `prstshp_lang` a LEFT JOIN `prstshp_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1 WHERE (a.`id_lang` = 1) LIMIT 1 |
0.142 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 45 | SELECT SQL_NO_CACHE * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1 LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1 WHERE (a.`id_category` = 471) AND (b.`id_shop` = 1) LIMIT 1 |
0.142 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 55 | SELECT SQL_NO_CACHE * FROM `prstshp_country` a LEFT JOIN `prstshp_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1 WHERE (a.`id_country` = 8) LIMIT 1 |
0.142 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 31 | SELECT SQL_NO_CACHE * FROM `prstshp_group` a LEFT JOIN `prstshp_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1 WHERE (a.`id_group` = 1) LIMIT 1 |
0.142 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 272 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcontactpage" LIMIT 1 |
0.141 ms | 1 | /classes/module/Module.php:2664 | ||
| 193 | SELECT SQL_NO_CACHE `name` FROM `prstshp_manufacturer` WHERE `id_manufacturer` = 20 AND `active` = 1 LIMIT 1 |
0.140 ms | 1 | /classes/Manufacturer.php:312 | ||
| 198 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `prstshp_product_shop` WHERE `id_product` = 1633 AND id_shop=1 LIMIT 1 |
0.138 ms | 1 | /classes/Product.php:6873 | ||
| 30 | SELECT SQL_NO_CACHE id_shop FROM `prstshp_currency_shop` WHERE `id_currency` = 1 AND id_shop = 1 LIMIT 1 |
0.136 ms | 1 | /classes/ObjectModel.php:1724 | ||
| 191 | SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 475 LIMIT 1 |
0.135 ms | 1 | /classes/Product.php:5659 | ||
| 32 | SELECT SQL_NO_CACHE * FROM `prstshp_group_lang` WHERE `id_group` = 1 |
0.134 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 218 | SELECT SQL_NO_CACHE name FROM prstshp_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 475 LIMIT 1 |
0.134 ms | 1 | /classes/Product.php:5659 | ||
| 246 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_currencyselector" LIMIT 1 |
0.134 ms | 1 | /classes/module/Module.php:2664 | ||
| 14 | SELECT SQL_NO_CACHE `name`, `alias` FROM `prstshp_hook_alias` |
0.133 ms | 88 | /classes/Hook.php:290 | ||
| 204 | SELECT SQL_NO_CACHE `reduction` FROM `prstshp_product_group_reduction_cache` WHERE `id_product` = 1633 AND `id_group` = 1 LIMIT 1 |
0.133 ms | 0 | /classes/GroupReduction.php:153 | ||
| 20 | SELECT SQL_NO_CACHE * FROM `prstshp_hook_module_exceptions` WHERE `id_shop` IN (1) |
0.132 ms | 1 | /classes/module/Module.php:2046 | ||
| 50 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_legalcompliance" LIMIT 1 |
0.131 ms | 0 | /classes/module/Module.php:2664 | ||
| 222 | SELECT SQL_NO_CACHE 1 FROM `prstshp_specific_price` WHERE id_product = 1547 LIMIT 1 |
0.131 ms | 1 | /classes/SpecificPrice.php:435 | ||
| 270 | SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `prstshp_category` c WHERE c.`id_category` = 2 LIMIT 1 |
0.131 ms | 1 | /classes/Category.php:1589 | ||
| 257 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 97 AND `id_shop` = 1 LIMIT 1 |
0.130 ms | 1 | /classes/module/Module.php:2137 | ||
| 220 | SELECT SQL_NO_CACHE `name` FROM `prstshp_manufacturer` WHERE `id_manufacturer` = 18 AND `active` = 1 LIMIT 1 |
0.128 ms | 1 | /classes/Manufacturer.php:312 | ||
| 3 | SELECT SQL_NO_CACHE * FROM `prstshp_shop` a WHERE (a.`id_shop` = 1) LIMIT 1 |
0.127 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 247 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 17 AND `id_shop` = 1 LIMIT 1 |
0.127 ms | 1 | /classes/module/Module.php:2137 | ||
| 254 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitmegamenu" LIMIT 1 |
0.127 ms | 1 | /classes/module/Module.php:2664 | ||
| 25 | SELECT SQL_NO_CACHE c.id_currency FROM `prstshp_currency` c WHERE (iso_code = 'EUR') LIMIT 1 |
0.127 ms | 1 | /classes/Currency.php:893 | ||
| 29 | SELECT SQL_NO_CACHE * FROM `prstshp_currency_lang` WHERE `id_currency` = 1 |
0.127 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 261 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1 |
0.127 ms | 1 | /classes/module/Module.php:2137 | ||
| 205 | SELECT SQL_NO_CACHE `reduction` FROM `prstshp_group` WHERE `id_group` = 1 LIMIT 1 |
0.126 ms | 1 | /classes/Group.php:151 | ||
| 7 | SELECT SQL_NO_CACHE * FROM `prstshp_shop_group` a WHERE (a.`id_shop_group` = 1) LIMIT 1 |
0.125 ms | 1 | /src/Adapter/EntityMapper.php:71 | ||
| 34 | SELECT SQL_NO_CACHE `id_category` FROM `prstshp_category_shop` WHERE `id_category` = 465 AND `id_shop` = 1 LIMIT 1 |
0.125 ms | 1 | /classes/Category.php:2446 | ||
| 56 | SELECT SQL_NO_CACHE * FROM `prstshp_country_lang` WHERE `id_country` = 8 |
0.125 ms | 1 | /src/Adapter/EntityMapper.php:79 | ||
| 251 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitsearch" LIMIT 1 |
0.125 ms | 1 | /classes/module/Module.php:2664 | ||
| 276 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.125 ms | 0 | /classes/module/Module.php:2137 | ||
| 277 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitcookielaw" LIMIT 1 |
0.125 ms | 1 | /classes/module/Module.php:2664 | ||
| 36 | SELECT SQL_NO_CACHE state FROM prstshp_feature_flag WHERE name = 'multiple_image_format' LIMIT 1 |
0.124 ms | 1 | /classes/FeatureFlag.php:105 | ||
| 249 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "iqitwishlist" LIMIT 1 |
0.124 ms | 1 | /classes/module/Module.php:2664 | ||
| 63 | SELECT SQL_NO_CACHE * FROM `prstshp_shop_url` a0 |
0.123 ms | 1 | /classes/PrestaShopCollection.php:383 | ||
| 255 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 95 AND `id_shop` = 1 LIMIT 1 |
0.122 ms | 1 | /classes/module/Module.php:2137 | ||
| 35 | SELECT SQL_NO_CACHE ctg.`id_group` FROM prstshp_category_group ctg WHERE ctg.`id_category` = 465 AND ctg.`id_group` = 1 LIMIT 1 |
0.121 ms | 1 | /classes/Category.php:1751 | ||
| 252 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 100 AND `id_shop` = 1 LIMIT 1 |
0.121 ms | 1 | /classes/module/Module.php:2137 | ||
| 278 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1 |
0.120 ms | 1 | /classes/module/Module.php:2137 | ||
| 53 | SELECT SQL_NO_CACHE format FROM `prstshp_address_format` WHERE `id_country` = 8 LIMIT 1 |
0.119 ms | 1 | /classes/AddressFormat.php:653 | ||
| 65 | SELECT SQL_NO_CACHE `id_category` FROM `prstshp_category_shop` WHERE `id_category` = 465 AND `id_shop` = 1 LIMIT 1 |
0.118 ms | 1 | /classes/Category.php:2446 | ||
| 224 | SELECT SQL_NO_CACHE `id_tax_rules_group` FROM `prstshp_product_shop` WHERE `id_product` = 1547 AND id_shop=1 LIMIT 1 |
0.118 ms | 1 | /classes/Product.php:6873 | ||
| 273 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1 |
0.117 ms | 1 | /classes/module/Module.php:2137 | ||
| 275 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module` WHERE `name` = "ps_emailsubscription" LIMIT 1 |
0.117 ms | 0 | /classes/module/Module.php:2664 | ||
| 33 | SELECT SQL_NO_CACHE id_shop FROM `prstshp_group_shop` WHERE `id_group` = 1 AND id_shop = 1 LIMIT 1 |
0.114 ms | 1 | /classes/ObjectModel.php:1724 | ||
| 250 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 103 AND `id_shop` = 1 LIMIT 1 |
0.114 ms | 1 | /classes/module/Module.php:2137 | ||
| 38 | SELECT SQL_NO_CACHE * FROM `prstshp_image_type` |
0.113 ms | 8 | /classes/ImageType.php:161 | ||
| 54 | SELECT SQL_NO_CACHE `need_identification_number` FROM `prstshp_country` WHERE `id_country` = 8 LIMIT 1 |
0.113 ms | 1 | /classes/Country.php:402 | ||
| 51 | SELECT SQL_NO_CACHE `id_module` FROM `prstshp_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1 |
0.112 ms | 0 | /classes/module/Module.php:2137 | ||
| 225 | SELECT SQL_NO_CACHE `reduction` FROM `prstshp_product_group_reduction_cache` WHERE `id_product` = 1547 AND `id_group` = 1 LIMIT 1 |
0.112 ms | 0 | /classes/GroupReduction.php:153 | ||
| 9 | SELECT SQL_NO_CACHE id_shop FROM `prstshp_lang_shop` WHERE `id_lang` = 1 AND id_shop = 1 LIMIT 1 |
0.108 ms | 1 | /classes/ObjectModel.php:1724 | ||
| 64 | SELECT SQL_NO_CACHE * FROM `prstshp_shop_url` a0 |
0.108 ms | 1 | /classes/PrestaShopCollection.php:383 | ||
| 57 | SELECT SQL_NO_CACHE id_required_field, object_name, field_name FROM prstshp_required_field |
0.104 ms | 1 | /classes/ObjectModel.php:1589 |
| 57 queries |
SELECT DISTINCT a.`id_attribute`, a.`color`, al.`name`, agl.`id_attribute_group`, IF(lialv.`url_name` IS NULL OR lialv.`url_name` = "", NULL, lialv.`url_name`) AS url_name, IF(lialv.`meta_title` IS NULL OR lialv.`meta_title` = "", NULL, lialv.`meta_title`) AS meta_title FROM `prstshp_attribute_group` ag INNER JOIN `prstshp_attribute_group_lang` agl ON (ag.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX) INNER JOIN `prstshp_attribute` a ON a.`id_attribute_group` = ag.`id_attribute_group` INNER JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX) INNER JOIN prstshp_attribute_group_shop attribute_group_shop
ON (attribute_group_shop.id_attribute_group = ag.id_attribute_group AND attribute_group_shop.id_shop = XX) INNER JOIN prstshp_attribute_shop attribute_shop
ON (attribute_shop.id_attribute = a.id_attribute AND attribute_shop.id_shop = XX) LEFT JOIN `prstshp_layered_indexable_attribute_lang_value` lialv ON (a.`id_attribute` = lialv.`id_attribute` AND lialv.`id_lang` = XX) WHERE ag.id_attribute_group = XX ORDER BY agl.`name` ASC, a.`position` ASC
|
| 55 queries |
SELECT pac.id_attribute, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pa.id_product_attribute, cp.position FROM prstshp_product p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN prstshp_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX AND sa.id_shop_group = XX ) LEFT JOIN prstshp_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN prstshp_category_product cp ON (p.id_product = cp.id_product) INNER JOIN prstshp_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN prstshp_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN prstshp_category_group cg ON (cg.id_category = c.id_category) WHERE ((pac.id_attribute IN (XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p LEFT JOIN prstshp_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN prstshp_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) INNER JOIN prstshp_attribute a ON (a.id_attribute = pac.id_attribute) LEFT JOIN prstshp_product_attribute_combination pac_XX ON (pa.id_product_attribute = pac_XX.id_product_attribute) WHERE ((a.id_attribute_group=XX)) AND ((pac_XX.id_attribute IN (XX, XX, XX, XX))) GROUP BY pac.id_attribute
|
| 12 queries |
SELECT * FROM `prstshp_category` a LEFT JOIN `prstshp_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX LEFT JOIN `prstshp_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX |
| 11 queries |
SELECT `id_module` FROM `prstshp_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX |
| 7 queries |
SELECT hbl.html,hb.style,hbl.id_lang
FROM `prstshp_ets_hb_html_box` hb
LEFT JOIN `prstshp_ets_hb_html_box_lang` hbl
ON (hb.`id_ets_hb_html_box` = hbl.`id_ets_hb_html_box` AND hbl.`id_lang` = XX)
JOIN `prstshp_ets_hb_html_box_position` hbp
ON (hbp.`id_ets_hb_html_box` = hb.`id_ets_hb_html_box`)
WHERE hb.active = XX
AND hbp.`position` = XX
|
| 4 queries |
SELECT SUM(quantity) FROM `prstshp_stock_available` WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX |
| 4 queries |
SELECT
COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
COALESCE(SUM(first_level_quantity), XX) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
FROM `prstshp_cart_product` cp
WHERE cp.`id_product_attribute` = XX
AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `prstshp_cart_product` cp JOIN `prstshp_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `prstshp_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = XX
AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
pr.`pack_stock_type` = XX
AND XX = XX
))) as q LIMIT XX
|
| 3 queries |
SELECT XX FROM `prstshp_specific_price` WHERE id_product = XX LIMIT XX |
| 3 queries |
SELECT tr.*
FROM `prstshp_tax_rule` tr
JOIN `prstshp_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = XX
AND tr.`id_country` = XX
AND tr.`id_tax_rules_group` = XX
AND tr.`id_state` IN (XX, XX)
AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
|
| 2 queries |
SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `prstshp_module` m
LEFT JOIN `prstshp_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = XX
|
| 2 queries |
SELECT `id_lang` FROM `prstshp_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT XX
|
| 2 queries |
SELECT `id_category` FROM `prstshp_category_shop` WHERE `id_category` = XX AND `id_shop` = XX LIMIT XX |
| 2 queries |
SELECT * FROM `prstshp_shop_url` aXX |
| 2 queries |
SELECT image_shop.`id_image`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
WHERE i.`id_product` = XX
AND image_shop.`cover` = XX LIMIT XX
|
| 2 queries |
SELECT name FROM prstshp_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX |
| 2 queries |
SELECT * FROM `prstshp_product` a LEFT JOIN `prstshp_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX LEFT JOIN `prstshp_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX |
| 2 queries |
SELECT `name` FROM `prstshp_manufacturer` WHERE `id_manufacturer` = XX AND `active` = XX LIMIT XX |
| 2 queries |
SELECT product_attribute_shop.`price`
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
WHERE pa.`id_product_attribute` = XX LIMIT XX
|
| 2 queries |
SELECT product_shop.`price`, product_shop.`ecotax`, IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax FROM `prstshp_product` p INNER JOIN `prstshp_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX) LEFT JOIN `prstshp_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX) WHERE (p.`id_product` = XX) |
| 2 queries |
SELECT `id_tax_rules_group`
FROM `prstshp_product_shop`
WHERE `id_product` = XX AND id_shop=XX LIMIT XX
|
| 2 queries |
SELECT `reduction` FROM `prstshp_product_group_reduction_cache` WHERE `id_product` = XX AND `id_group` = XX LIMIT XX |
| 2 queries |
SELECT pa.`available_date` FROM `prstshp_product` p LEFT JOIN `prstshp_product_attribute` pa ON (pa.`id_product` = p.`id_product`) INNER JOIN prstshp_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX) WHERE p.`id_product` = XX AND pa.`id_product` = XX AND pa.`id_product_attribute` = XX LIMIT XX
|
| 2 queries |
SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM prstshp_feature_product pf
LEFT JOIN prstshp_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
LEFT JOIN prstshp_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
LEFT JOIN prstshp_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
INNER JOIN prstshp_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
WHERE pf.id_product = XX
ORDER BY f.position ASC
|
| 2 queries |
SELECT a.`id_attribute`, a.`id_attribute_group`, al.`name`, agl.`name` as `group`, agl.`public_name` as `public_group`,
pa.`reference`, pa.`eanXX`, pa.`isbn`, pa.`upc`, pa.`mpn`,
pal.`available_now`, pal.`available_later`
FROM `prstshp_attribute` a
LEFT JOIN `prstshp_attribute_lang` al
ON (al.`id_attribute` = a.`id_attribute` AND al.`id_lang` = XX)
LEFT JOIN `prstshp_product_attribute_combination` pac
ON (pac.`id_attribute` = a.`id_attribute`)
LEFT JOIN `prstshp_product_attribute` pa
ON (pa.`id_product_attribute` = pac.`id_product_attribute`)
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
LEFT JOIN `prstshp_product_attribute_lang` pal
ON (pal.`id_product_attribute` = pac.`id_product_attribute` AND pal.`id_lang` = XX)
LEFT JOIN `prstshp_attribute_group_lang` agl
ON (a.`id_attribute_group` = agl.`id_attribute_group` AND agl.`id_lang` = XX)
WHERE pa.`id_product` = XX
AND pac.`id_product_attribute` = XX
AND agl.`id_lang` = XX
|
| 2 queries |
SELECT * FROM `prstshp_product_attribute` a LEFT JOIN `prstshp_product_attribute_shop` `c` ON a.`id_product_attribute` = c.`id_product_attribute` AND c.`id_shop` = XX WHERE (a.`id_product_attribute` = XX) LIMIT XX |
| 2 queries |
SELECT * FROM `prstshp_product_attribute_lang` WHERE `id_product_attribute` = XX |
| 2 queries |
SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `prstshp_image` i
INNER JOIN prstshp_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
LEFT JOIN `prstshp_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
WHERE i.`id_product` = XX
ORDER BY `position`
|
| 2 queries |
SELECT `id_product_attribute`
FROM `prstshp_product_attribute`
WHERE `id_product` = XX
|
| 2 queries |
SELECT XX FROM `prstshp_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX |
| 2 queries |
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `prstshp_product_attribute` pa
INNER JOIN prstshp_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
JOIN `prstshp_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `prstshp_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `prstshp_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
JOIN `prstshp_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
|
| 174 product_attribute_combination |
| 128 product_attribute |
| 117 attribute |
| 81 category |
| 70 product |
| 68 product_shop |
| 63 stock_available |
| 62 category_group |
| 61 attribute_lang |
| 60 attribute_group |
| 60 attribute_group_lang |
| 60 category_product |
| 58 attribute_group_shop |
| 58 product_sale |
| 57 attribute_shop |
| 57 layered_indexable_attribute_lang_value |
| 23 category_lang |
| 18 category_shop |
| 15 module |
| 14 module_shop |
| 12 product_attribute_shop |
| 10 cart_product |
| 7 ets_hb_html_box |
| 7 ets_hb_html_box_lang |
| 7 ets_hb_html_box_position |
| 6 shop_url |
| 6 hook |
| 6 image |
| 5 lang |
| 5 currency |
| 4 shop |
| 4 lang_shop |
| 4 currency_shop |
| 4 image_shop |
| 4 pack |
| 4 product_attribute_lang |
| 4 image_lang |
| 3 country |
| 3 hook_alias |
| 3 image_type |
| 3 product_lang |
| 3 specific_price |
| 3 tax_rule |
| 3 tax_rules_group |
| 2 shop_group |
| 2 configuration |
| 2 country_lang |
| 2 country_shop |
| 2 hook_module |
| 2 currency_lang |
| 2 group |
| 2 group_shop |
| 2 manufacturer |
| 2 product_group_reduction_cache |
| 2 feature_product |
| 2 feature_lang |
| 2 feature_value_lang |
| 2 feature |
| 2 feature_shop |
| 2 product_attribute_image |
| 2 iqit_elementor_category |
| 2 cart_rule |
| 1 configuration_lang |
| 1 module_group |
| 1 meta |
| 1 meta_lang |
| 1 hook_module_exceptions |
| 1 group_lang |
| 1 feature_flag |
| 1 address_format |
| 1 required_field |
| 1 layered_category |
| 1 layered_indexable_attribute_group |
| 1 layered_indexable_attribute_group_lang_value |
| 1 layered_filter_block |
| 1 tax |
| 1 tax_lang |
| 1 iqit_elementor_category_shop |
| 1 connections |
| Name | Instances | Source |
|---|---|---|
| Category | 18 |
/controllers/front/listing/CategoryController.php:76 (__construct) [id: 465]
/controllers/front/listing/CategoryController.php:214 (__construct) [id: 466] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 467] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 468] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 469] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 470] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 471] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 472] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 473] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 474] /controllers/front/listing/CategoryController.php:214 (__construct) [id: 475] /classes/Meta.php:380 (__construct) [id: 465] /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] /classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] /modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 465] /modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 465] /modules/ps_categorytree/ps_categorytree.php:364 (getParentsCategories) [id: 2] |
| Product | 6 |
/classes/Link.php:113 (__construct) [id: 1633]
/classes/Link.php:113 (__construct) [id: 1547] /src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1633] /src/Adapter/Image/ImageRetriever.php:77 (__construct) [id: 1547] /classes/Link.php:113 (__construct) [id: 1633] /classes/Link.php:113 (__construct) [id: 1547] |
| Country | 5 |
/config/config.inc.php:146 (__construct) [id: 8]
/classes/AddressFormat.php:404 (__construct) [id: 8] /classes/controller/FrontController.php:1779 (__construct) [id: 8] /modules/paypal/paypal.php:307 (__construct) [id: 8] /modules/paypal/classes/AbstractMethodPaypal.php:83 (__construct) [id: 8] |
| Address | 4 |
/classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ] /classes/Product.php:3804 (__construct) [id: ] /classes/Product.php:5964 (__construct) [id: ] |
| ShopUrl | 2 |
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ] |
| Language | 2 |
/config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1] |
| Combination | 2 |
/classes/Product.php:5912 (__construct) [id: 22357]
/classes/Product.php:5912 (__construct) [id: 20705] |
| Currency | 2 |
/src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1] |
| Cart | 2 |
/classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ] |
| Tax | 2 |
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 39]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 39] |
| Shop | 1 |
/config/config.inc.php:117 (initialize) [id: 1]
|
| IqitElementorCategory | 1 |
/modules/iqitelementor/iqitelementor.php:853 (isJustElementor) [id: ]
|
| Risk | 1 |
/classes/controller/FrontController.php:1705 (__construct) [id: ]
|
| State | 1 |
/classes/controller/FrontController.php:1778 (__construct) [id: 0]
|
| AddressFormat | 1 |
/classes/controller/FrontController.php:1773 (generateAddress) [id: ]
|
| Gender | 1 |
/classes/controller/FrontController.php:1702 (__construct) [id: 0]
|
| Group | 1 |
/classes/Cart.php:249 (getCurrent) [id: 1]
|
| Customer | 1 |
/config/config.inc.php:264 (__construct) [id: ]
|
| ShopGroup | 1 |
/classes/shop/Shop.php:561 (__construct) [id: 1]
|
| ConnectionsSource | 1 |
/modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]
|
| # | Filename |
|---|---|
| 0 | /index.php |
| 1 | /config/config.inc.php |
| 2 | /config/defines.inc.php |
| 3 | /config/autoload.php |
| 4 | /vendor/autoload.php |
| 5 | /vendor/composer/autoload_real.php |
| 6 | /vendor/composer/platform_check.php |
| 7 | /vendor/composer/ClassLoader.php |
| 8 | /vendor/composer/include_paths.php |
| 9 | /vendor/composer/autoload_static.php |
| 10 | /vendor/symfony/polyfill-php72/bootstrap.php |
| 11 | /vendor/symfony/polyfill-mbstring/bootstrap.php |
| 12 | /vendor/symfony/polyfill-mbstring/bootstrap80.php |
| 13 | /vendor/symfony/polyfill-intl-normalizer/bootstrap.php |
| 14 | /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php |
| 15 | /vendor/symfony/polyfill-intl-idn/bootstrap.php |
| 16 | /vendor/symfony/deprecation-contracts/function.php |
| 17 | /vendor/ralouphie/getallheaders/src/getallheaders.php |
| 18 | /vendor/symfony/polyfill-ctype/bootstrap.php |
| 19 | /vendor/symfony/polyfill-ctype/bootstrap80.php |
| 20 | /vendor/symfony/polyfill-php80/bootstrap.php |
| 21 | /vendor/guzzlehttp/promises/src/functions_include.php |
| 22 | /vendor/guzzlehttp/promises/src/functions.php |
| 23 | /vendor/guzzlehttp/guzzle/src/functions_include.php |
| 24 | /vendor/guzzlehttp/guzzle/src/functions.php |
| 25 | /vendor/symfony/polyfill-iconv/bootstrap.php |
| 26 | /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php |
| 27 | /vendor/jakeasmith/http_build_url/src/http_build_url.php |
| 28 | /vendor/lcobucci/jwt/compat/class-aliases.php |
| 29 | /vendor/lcobucci/jwt/src/Token.php |
| 30 | /vendor/lcobucci/jwt/src/Signature.php |
| 31 | /vendor/lcobucci/jwt/compat/json-exception-polyfill.php |
| 32 | /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php |
| 33 | /vendor/swiftmailer/swiftmailer/lib/swift_required.php |
| 34 | /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php |
| 35 | /vendor/symfony/polyfill-intl-icu/bootstrap.php |
| 36 | /vendor/symfony/polyfill-php73/bootstrap.php |
| 37 | /vendor/symfony/polyfill-php81/bootstrap.php |
| 38 | /vendor/api-platform/core/src/deprecation.php |
| 39 | /vendor/api-platform/core/src/Api/FilterInterface.php |
| 40 | /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php |
| 41 | /vendor/api-platform/core/src/deprecated_interfaces.php |
| 42 | /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php |
| 43 | /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php |
| 44 | /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php |
| 45 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php |
| 46 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php |
| 47 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php |
| 48 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php |
| 49 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php |
| 50 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php |
| 51 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php |
| 52 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php |
| 53 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php |
| 54 | /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php |
| 55 | /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php |
| 56 | /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php |
| 57 | /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php |
| 58 | /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php |
| 59 | /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php |
| 60 | /vendor/api-platform/core/src/Exception/ExceptionInterface.php |
| 61 | /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php |
| 62 | /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php |
| 63 | /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php |
| 64 | /vendor/api-platform/core/src/Documentation/DocumentationInterface.php |
| 65 | /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php |
| 66 | /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php |
| 67 | /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php |
| 68 | /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php |
| 69 | /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php |
| 70 | /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php |
| 71 | /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php |
| 72 | /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php |
| 73 | /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php |
| 74 | /vendor/api-platform/core/src/Validator/ValidatorInterface.php |
| 75 | /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php |
| 76 | /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php |
| 77 | /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php |
| 78 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php |
| 79 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php |
| 80 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php |
| 81 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php |
| 82 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php |
| 83 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php |
| 84 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php |
| 85 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php |
| 86 | /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php |
| 87 | /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php |
| 88 | /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php |
| 89 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php |
| 90 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php |
| 91 | /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php |
| 92 | /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php |
| 93 | /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php |
| 94 | /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php |
| 95 | /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php |
| 96 | /vendor/psr/container/src/ContainerInterface.php |
| 97 | /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php |
| 98 | /vendor/ircmaxell/password-compat/lib/password.php |
| 99 | /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php |
| 100 | /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php |
| 101 | /src/Core/Version.php |
| 102 | /config/alias.php |
| 103 | /vendor/prestashop/autoload/src/PrestashopAutoload.php |
| 104 | /vendor/prestashop/autoload/src/LegacyClassLoader.php |
| 105 | /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php |
| 106 | /vendor/prestashop/autoload/src/Autoloader.php |
| 107 | /config/bootstrap.php |
| 108 | /src/Core/ContainerBuilder.php |
| 109 | /src/Core/Foundation/IoC/Container.php |
| 110 | /src/Adapter/ServiceLocator.php |
| 111 | /var/cache/dev/appParameters.php |
| 114 | /var/cache/dev/class_index.php |
| 115 | /classes/controller/Controller.php |
| 117 | /classes/ObjectModel.php |
| 118 | /src/Core/Foundation/Database/EntityInterface.php |
| 120 | /classes/db/Db.php |
| 122 | /classes/Hook.php |
| 124 | /classes/module/Module.php |
| 125 | /src/Core/Module/Legacy/ModuleInterface.php |
| 127 | /classes/Tools.php |
| 128 | /classes/Context.php |
| 129 | /classes/shop/Shop.php |
| 130 | /src/Core/Security/PasswordGenerator.php |
| 131 | /classes/db/DbPDO.php |
| 132 | /classes/AddressFormat.php |
| 133 | /classes/Configuration.php |
| 134 | /classes/Validate.php |
| 135 | /classes/cache/Cache.php |
| 136 | /src/Adapter/EntityMapper.php |
| 137 | /classes/db/DbQuery.php |
| 138 | /src/Core/Addon/Theme/ThemeManagerBuilder.php |
| 139 | /vendor/psr/log/Psr/Log/NullLogger.php |
| 140 | /vendor/psr/log/Psr/Log/AbstractLogger.php |
| 141 | /vendor/psr/log/Psr/Log/LoggerInterface.php |
| 142 | /src/Adapter/Configuration.php |
| 143 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php |
| 144 | /src/Core/Domain/Configuration/ShopConfigurationInterface.php |
| 145 | /src/Core/ConfigurationInterface.php |
| 146 | /src/Core/Addon/Theme/ThemeRepository.php |
| 147 | /src/Core/Addon/AddonRepositoryInterface.php |
| 148 | /src/Core/Domain/Shop/ValueObject/ShopConstraint.php |
| 149 | /src/Core/Addon/Theme/Theme.php |
| 150 | /src/Core/Addon/AddonInterface.php |
| 151 | /src/Core/Util/ArrayFinder.php |
| 152 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php |
| 153 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php |
| 154 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php |
| 155 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php |
| 156 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php |
| 157 | /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php |
| 158 | /config/defines_uri.inc.php |
| 159 | /override/classes/Language.php |
| 160 | /classes/Language.php |
| 161 | /src/Core/Language/LanguageInterface.php |
| 162 | /classes/Country.php |
| 163 | /classes/PrestaShopCollection.php |
| 164 | /classes/shop/ShopGroup.php |
| 165 | /classes/Cookie.php |
| 166 | /classes/PhpEncryption.php |
| 167 | /classes/PhpEncryptionEngine.php |
| 168 | /vendor/defuse/php-encryption/src/Key.php |
| 169 | /vendor/defuse/php-encryption/src/Encoding.php |
| 170 | /vendor/defuse/php-encryption/src/Core.php |
| 171 | /vendor/defuse/php-encryption/src/Crypto.php |
| 172 | /vendor/defuse/php-encryption/src/KeyOrPassword.php |
| 173 | /vendor/defuse/php-encryption/src/RuntimeTests.php |
| 174 | /vendor/defuse/php-encryption/src/DerivedKeys.php |
| 175 | /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php |
| 176 | /vendor/defuse/php-encryption/src/Exception/CryptoException.php |
| 177 | /src/Core/Session/SessionHandler.php |
| 178 | /src/Core/Session/SessionHandlerInterface.php |
| 179 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php |
| 180 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php |
| 181 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php |
| 182 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php |
| 183 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php |
| 184 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php |
| 185 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php |
| 186 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php |
| 187 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php |
| 188 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php |
| 189 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php |
| 190 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php |
| 191 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php |
| 192 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php |
| 193 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php |
| 194 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php |
| 195 | /config/smarty.config.inc.php |
| 196 | /classes/Smarty/SmartyDev.php |
| 197 | /vendor/smarty/smarty/libs/Smarty.class.php |
| 198 | /vendor/smarty/smarty/libs/functions.php |
| 199 | /vendor/smarty/smarty/libs/Autoloader.php |
| 200 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php |
| 201 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php |
| 202 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php |
| 203 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php |
| 204 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php |
| 205 | /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php |
| 206 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php |
| 207 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php |
| 208 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php |
| 209 | /config/smartyfront.config.inc.php |
| 210 | /classes/Smarty/SmartyResourceModule.php |
| 211 | /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php |
| 212 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php |
| 213 | /classes/Smarty/SmartyResourceParent.php |
| 214 | /classes/Smarty/SmartyLazyRegister.php |
| 215 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php |
| 216 | /vendor/smarty/smarty/libs/plugins/modifier.truncate.php |
| 217 | /classes/Customer.php |
| 218 | /classes/Group.php |
| 219 | /classes/Link.php |
| 220 | /classes/shop/ShopUrl.php |
| 221 | /classes/Dispatcher.php |
| 222 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php |
| 223 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php |
| 224 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php |
| 225 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php |
| 226 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php |
| 227 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php |
| 228 | /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php |
| 229 | /src/Adapter/SymfonyContainer.php |
| 230 | /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php |
| 231 | /config/db_slave_server.inc.php |
| 232 | /src/Adapter/ContainerBuilder.php |
| 233 | /src/Adapter/Environment.php |
| 234 | /src/Core/EnvironmentInterface.php |
| 235 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php |
| 236 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php |
| 237 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php |
| 238 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php |
| 239 | /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php |
| 240 | /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php |
| 241 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php |
| 242 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php |
| 243 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php |
| 244 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php |
| 245 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php |
| 246 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php |
| 247 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php |
| 248 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php |
| 249 | /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php |
| 250 | /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php |
| 251 | /vendor/symfony/contracts/Service/ResetInterface.php |
| 252 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php |
| 253 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php |
| 254 | /vendor/psr/log/Psr/Log/LoggerAwareTrait.php |
| 255 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php |
| 256 | /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php |
| 257 | /vendor/symfony/contracts/Cache/ItemInterface.php |
| 258 | /vendor/psr/cache/src/CacheItemInterface.php |
| 259 | /vendor/psr/cache/src/CacheItemPoolInterface.php |
| 260 | /vendor/symfony/contracts/Cache/CacheInterface.php |
| 261 | /vendor/psr/log/Psr/Log/LoggerAwareInterface.php |
| 262 | /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php |
| 263 | /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php |
| 264 | /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php |
| 265 | /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php |
| 266 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php |
| 267 | /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php |
| 268 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php |
| 269 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php |
| 270 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php |
| 271 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php |
| 272 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php |
| 273 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php |
| 274 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php |
| 275 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php |
| 276 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php |
| 277 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php |
| 278 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php |
| 279 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php |
| 280 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php |
| 281 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php |
| 282 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php |
| 283 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php |
| 284 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php |
| 285 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php |
| 286 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php |
| 287 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php |
| 288 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php |
| 289 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php |
| 290 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php |
| 291 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php |
| 292 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php |
| 293 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php |
| 294 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php |
| 295 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php |
| 296 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php |
| 297 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php |
| 298 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php |
| 299 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php |
| 300 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php |
| 301 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php |
| 302 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php |
| 303 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php |
| 304 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php |
| 305 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php |
| 306 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php |
| 307 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php |
| 308 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php |
| 309 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php |
| 310 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php |
| 311 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php |
| 312 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php |
| 313 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php |
| 314 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php |
| 315 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php |
| 316 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php |
| 317 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php |
| 318 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php |
| 319 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php |
| 320 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php |
| 321 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php |
| 322 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php |
| 323 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php |
| 324 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php |
| 325 | /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php |
| 326 | /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php |
| 327 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php |
| 328 | /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php |
| 329 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php |
| 330 | /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php |
| 331 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php |
| 332 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php |
| 333 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php |
| 334 | /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php |
| 335 | /var/cache/dev/FrontContainer.php |
| 336 | /src/Adapter/Container/LegacyContainer.php |
| 337 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php |
| 338 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php |
| 339 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php |
| 340 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php |
| 341 | /vendor/symfony/contracts/Service/ServiceLocatorTrait.php |
| 342 | /vendor/psr/container/src/ContainerExceptionInterface.php |
| 343 | /vendor/psr/container/src/NotFoundExceptionInterface.php |
| 344 | /vendor/symfony/contracts/Service/ServiceProviderInterface.php |
| 345 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php |
| 346 | /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php |
| 347 | /src/Adapter/Container/LegacyContainerInterface.php |
| 348 | /modules/dashactivity/vendor/autoload.php |
| 349 | /modules/dashactivity/vendor/composer/autoload_real.php |
| 350 | /modules/dashactivity/vendor/composer/platform_check.php |
| 351 | /modules/dashactivity/vendor/composer/autoload_static.php |
| 352 | /modules/dashproducts/vendor/autoload.php |
| 353 | /modules/dashproducts/vendor/composer/autoload_real.php |
| 354 | /modules/dashproducts/vendor/composer/platform_check.php |
| 355 | /modules/dashproducts/vendor/composer/autoload_static.php |
| 356 | /modules/gsitemap/vendor/autoload.php |
| 357 | /modules/gsitemap/vendor/composer/autoload_real.php |
| 358 | /modules/gsitemap/vendor/composer/platform_check.php |
| 359 | /modules/gsitemap/vendor/composer/autoload_static.php |
| 360 | /modules/pagesnotfound/vendor/autoload.php |
| 361 | /modules/pagesnotfound/vendor/composer/autoload_real.php |
| 362 | /modules/pagesnotfound/vendor/composer/autoload_static.php |
| 363 | /modules/ps_categorytree/vendor/autoload.php |
| 364 | /modules/ps_categorytree/vendor/composer/autoload_real.php |
| 365 | /modules/ps_categorytree/vendor/composer/platform_check.php |
| 366 | /modules/ps_categorytree/vendor/composer/autoload_static.php |
| 367 | /modules/ps_themecusto/vendor/autoload.php |
| 368 | /modules/ps_themecusto/vendor/composer/autoload_real.php |
| 369 | /modules/ps_themecusto/vendor/composer/platform_check.php |
| 370 | /modules/ps_themecusto/vendor/composer/autoload_static.php |
| 371 | /modules/ps_wirepayment/vendor/autoload.php |
| 372 | /modules/ps_wirepayment/vendor/composer/autoload_real.php |
| 373 | /modules/ps_wirepayment/vendor/composer/platform_check.php |
| 374 | /modules/ps_wirepayment/vendor/composer/autoload_static.php |
| 375 | /modules/statscatalog/vendor/autoload.php |
| 376 | /modules/statscatalog/vendor/composer/autoload_real.php |
| 377 | /modules/statscatalog/vendor/composer/platform_check.php |
| 378 | /modules/statscatalog/vendor/composer/autoload_static.php |
| 379 | /modules/statscheckup/vendor/autoload.php |
| 380 | /modules/statscheckup/vendor/composer/autoload_real.php |
| 381 | /modules/statscheckup/vendor/composer/platform_check.php |
| 382 | /modules/statscheckup/vendor/composer/autoload_static.php |
| 383 | /modules/statsdata/vendor/autoload.php |
| 384 | /modules/statsdata/vendor/composer/autoload_real.php |
| 385 | /modules/statsdata/vendor/composer/platform_check.php |
| 386 | /modules/statsdata/vendor/composer/autoload_static.php |
| 387 | /modules/statsproduct/vendor/autoload.php |
| 388 | /modules/statsproduct/vendor/composer/autoload_real.php |
| 389 | /modules/statsproduct/vendor/composer/platform_check.php |
| 390 | /modules/statsproduct/vendor/composer/autoload_static.php |
| 391 | /modules/ps_facetedsearch/vendor/autoload.php |
| 392 | /modules/ps_facetedsearch/vendor/composer/autoload_real.php |
| 393 | /modules/ps_facetedsearch/vendor/composer/platform_check.php |
| 394 | /modules/ps_facetedsearch/vendor/composer/autoload_static.php |
| 395 | /modules/mondialrelay/vendor/autoload.php |
| 396 | /modules/mondialrelay/vendor/composer/autoload_real.php |
| 397 | /modules/mondialrelay/vendor/composer/autoload_static.php |
| 398 | /modules/paypal/vendor/autoload.php |
| 399 | /modules/paypal/vendor/composer/autoload_real.php |
| 400 | /modules/paypal/vendor/composer/autoload_static.php |
| 401 | /modules/paypal/vendor/paragonie/random_compat/lib/random.php |
| 402 | /modules/paypal/vendor/symfony/polyfill-php70/bootstrap.php |
| 403 | /modules/paypal/vendor/guzzlehttp/psr7/src/functions_include.php |
| 404 | /modules/paypal/vendor/guzzlehttp/psr7/src/functions.php |
| 405 | /modules/autoupgrade/vendor/autoload.php |
| 406 | /modules/autoupgrade/vendor/composer/autoload_real.php |
| 407 | /modules/autoupgrade/vendor/composer/autoload_static.php |
| 408 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php |
| 409 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php |
| 410 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php |
| 411 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php |
| 412 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php |
| 413 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php |
| 414 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php |
| 415 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php |
| 416 | /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php |
| 417 | /modules/ps_distributionapiclient/vendor/autoload.php |
| 418 | /modules/ps_distributionapiclient/vendor/composer/autoload_real.php |
| 419 | /modules/ps_distributionapiclient/vendor/composer/platform_check.php |
| 420 | /modules/ps_distributionapiclient/vendor/composer/autoload_static.php |
| 421 | /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php |
| 422 | /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php |
| 423 | /modules/ps_emailalerts/vendor/autoload.php |
| 424 | /modules/ps_emailalerts/vendor/composer/autoload_real.php |
| 425 | /modules/ps_emailalerts/vendor/composer/platform_check.php |
| 426 | /modules/ps_emailalerts/vendor/composer/autoload_static.php |
| 427 | /modules/ph_simpleblog/vendor/autoload.php |
| 428 | /modules/ph_simpleblog/vendor/composer/autoload_real.php |
| 429 | /modules/ph_simpleblog/vendor/composer/platform_check.php |
| 430 | /modules/ph_simpleblog/vendor/composer/autoload_static.php |
| 431 | /modules/ps_shoppingcart/vendor/autoload.php |
| 432 | /modules/ps_shoppingcart/vendor/composer/autoload_real.php |
| 433 | /modules/ps_shoppingcart/vendor/composer/platform_check.php |
| 434 | /modules/ps_shoppingcart/vendor/composer/autoload_static.php |
| 435 | /modules/stripe_official/vendor/autoload.php |
| 436 | /modules/stripe_official/vendor/composer/autoload_real.php |
| 437 | /modules/stripe_official/vendor/composer/platform_check.php |
| 438 | /modules/stripe_official/vendor/composer/autoload_static.php |
| 439 | /modules/paybox/vendor/autoload.php |
| 440 | /modules/paybox/vendor/composer/autoload_real.php |
| 441 | /modules/paybox/vendor/composer/platform_check.php |
| 442 | /modules/paybox/vendor/composer/autoload_static.php |
| 443 | /modules/paybox/vendor/clue/stream-filter/src/functions_include.php |
| 444 | /modules/paybox/vendor/clue/stream-filter/src/functions.php |
| 445 | /modules/paybox/vendor/php-http/message/src/filters.php |
| 446 | /modules/sendinblue/vendor/autoload.php |
| 447 | /modules/sendinblue/vendor/composer/autoload_real.php |
| 448 | /modules/sendinblue/vendor/composer/platform_check.php |
| 449 | /modules/sendinblue/vendor/composer/autoload_static.php |
| 450 | /src/Core/Hook/HookModuleFilter.php |
| 451 | /src/Core/Hook/HookModuleFilterInterface.php |
| 452 | /modules/ph_simpleblog/ph_simpleblog.php |
| 453 | /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php |
| 454 | /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php |
| 455 | /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php |
| 456 | /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php |
| 457 | /modules/ph_simpleblog/models/SimpleBlogCategory.php |
| 458 | /modules/ph_simpleblog/models/SimpleBlogPost.php |
| 459 | /modules/ph_simpleblog/models/SimpleBlogPostType.php |
| 460 | /modules/ph_simpleblog/models/SimpleBlogPostImage.php |
| 461 | /modules/ph_simpleblog/models/SimpleBlogTag.php |
| 462 | /modules/ph_simpleblog/models/SimpleBlogComment.php |
| 463 | /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php |
| 464 | /modules/ph_simpleblog/classes/SimpleBlogHelper.php |
| 465 | /modules/ph_simpleblog/classes/BlogPostsFinder.php |
| 466 | /modules/ph_simpleblog/controllers/front/default_list.php |
| 467 | /classes/controller/ModuleFrontController.php |
| 468 | /classes/controller/FrontController.php |
| 469 | /src/Core/Security/Hashing.php |
| 470 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php |
| 471 | /vendor/smarty/smarty/libs/sysplugins/smarty_data.php |
| 472 | /classes/Translate.php |
| 473 | /modules/ph_simpleblog/translations/fr.php |
| 474 | /src/PrestaShopBundle/Translation/TranslatorComponent.php |
| 475 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php |
| 476 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php |
| 477 | /vendor/symfony/contracts/Translation/LocaleAwareInterface.php |
| 478 | /vendor/symfony/contracts/Translation/TranslatorInterface.php |
| 479 | /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php |
| 480 | /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php |
| 481 | /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php |
| 482 | /src/PrestaShopBundle/Translation/TranslatorInterface.php |
| 483 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php |
| 484 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php |
| 485 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php |
| 486 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php |
| 487 | /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php |
| 488 | /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php |
| 489 | /vendor/symfony/contracts/Translation/TranslatorTrait.php |
| 490 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php |
| 491 | /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php |
| 492 | /var/cache/dev/translations/catalogue.fr-FR.NXhscRe.php |
| 493 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php |
| 494 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php |
| 495 | /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php |
| 496 | /controllers/front/listing/CategoryController.php |
| 497 | /classes/controller/ProductListingFrontController.php |
| 498 | /classes/controller/ProductPresentingFrontController.php |
| 499 | /src/Adapter/Presenter/Object/ObjectPresenter.php |
| 500 | /src/Adapter/Presenter/PresenterInterface.php |
| 501 | /src/Adapter/Presenter/Cart/CartPresenter.php |
| 502 | /src/Adapter/Image/ImageRetriever.php |
| 503 | /classes/tax/TaxConfiguration.php |
| 504 | /classes/Smarty/TemplateFinder.php |
| 505 | /classes/assets/StylesheetManager.php |
| 506 | /classes/assets/AbstractAssetManager.php |
| 507 | /src/Adapter/Assets/AssetUrlGeneratorTrait.php |
| 508 | /classes/assets/JavascriptManager.php |
| 509 | /classes/assets/CccReducer.php |
| 510 | /modules/iqitthemeeditor/iqitthemeeditor.php |
| 511 | /modules/iqitthemeeditor/src/IqitSmartyModifiers.php |
| 512 | /classes/Category.php |
| 513 | /classes/webservice/WebserviceRequest.php |
| 514 | /src/Core/Localization/Locale/Repository.php |
| 515 | /src/Core/Localization/Locale/RepositoryInterface.php |
| 516 | /src/Core/Localization/CLDR/LocaleRepository.php |
| 517 | /src/Core/Localization/CLDR/LocaleDataSource.php |
| 518 | /src/Core/Localization/CLDR/DataLayer/LocaleCache.php |
| 519 | /src/Core/Data/Layer/AbstractDataLayer.php |
| 520 | /src/Core/Localization/CLDR/LocaleDataLayerInterface.php |
| 521 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php |
| 522 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php |
| 523 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php |
| 524 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php |
| 525 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php |
| 526 | /vendor/symfony/contracts/Cache/CacheTrait.php |
| 527 | /vendor/psr/cache/src/InvalidArgumentException.php |
| 528 | /vendor/psr/cache/src/CacheException.php |
| 529 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php |
| 530 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php |
| 531 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php |
| 532 | /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php |
| 533 | /src/Core/Localization/CLDR/DataLayer/LocaleReference.php |
| 534 | /src/Core/Localization/CLDR/Reader.php |
| 535 | /src/Core/Localization/CLDR/ReaderInterface.php |
| 536 | /src/Core/Localization/Currency/Repository.php |
| 537 | /src/Core/Localization/Currency/RepositoryInterface.php |
| 538 | /src/Core/Localization/Currency/CurrencyDataSource.php |
| 539 | /src/Core/Localization/Currency/DataSourceInterface.php |
| 540 | /src/Core/Localization/Currency/DataLayer/CurrencyCache.php |
| 541 | /src/Core/Localization/Currency/CurrencyDataLayerInterface.php |
| 542 | /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php |
| 543 | /src/Adapter/Currency/CurrencyDataProvider.php |
| 544 | /src/Core/Currency/CurrencyDataProviderInterface.php |
| 545 | /src/Adapter/LegacyContext.php |
| 546 | /src/Adapter/Tools.php |
| 547 | /src/Core/Localization/Currency/DataLayer/CurrencyReference.php |
| 548 | /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php |
| 549 | /vendor/prestashop/decimal/src/Operation/Rounding.php |
| 550 | /src/Core/Localization/Locale.php |
| 551 | /src/Core/Localization/LocaleInterface.php |
| 552 | /src/Core/Localization/Specification/Price.php |
| 553 | /src/Core/Localization/Specification/Number.php |
| 554 | /src/Core/Localization/Specification/NumberInterface.php |
| 555 | /src/Core/Localization/Specification/Factory.php |
| 556 | /src/Core/Localization/CLDR/LocaleData.php |
| 557 | /src/Core/Localization/CLDR/NumberSymbolsData.php |
| 558 | /src/Core/Localization/CLDR/CurrencyData.php |
| 559 | /src/Core/Localization/CLDR/Locale.php |
| 560 | /src/Core/Localization/CLDR/LocaleInterface.php |
| 561 | /src/Core/Localization/Specification/NumberSymbolList.php |
| 562 | /classes/Currency.php |
| 563 | /src/Core/Localization/Currency/LocalizedCurrencyId.php |
| 564 | /src/Core/Localization/Currency/CurrencyData.php |
| 565 | /src/Core/Localization/Currency/CurrencyCollection.php |
| 566 | /src/Core/Localization/Currency.php |
| 567 | /src/Core/Localization/CurrencyInterface.php |
| 568 | /src/Core/Localization/Specification/NumberCollection.php |
| 569 | /src/Core/Localization/Number/Formatter.php |
| 570 | /override/classes/Cart.php |
| 571 | /classes/Cart.php |
| 572 | /src/Adapter/AddressFactory.php |
| 573 | /classes/CartRule.php |
| 574 | /classes/Product.php |
| 575 | /src/Core/Domain/Product/ValueObject/RedirectType.php |
| 576 | /src/Core/Util/DateTime/DateTime.php |
| 577 | /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php |
| 578 | /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php |
| 579 | /src/Core/Domain/Product/ValueObject/ProductType.php |
| 580 | /src/Core/Domain/Product/ValueObject/Reference.php |
| 581 | /src/Core/Domain/Product/ValueObject/Ean13.php |
| 582 | /src/Core/Domain/Product/ValueObject/Isbn.php |
| 583 | /src/Core/Domain/Product/ValueObject/Upc.php |
| 584 | /src/Core/Domain/Product/ProductSettings.php |
| 585 | /src/Core/Image/ImageFormatConfiguration.php |
| 586 | /src/Core/Image/ImageFormatConfigurationInterface.php |
| 587 | /classes/FeatureFlag.php |
| 588 | /src/Core/FeatureFlag/FeatureFlagSettings.php |
| 589 | /classes/ImageType.php |
| 590 | /classes/ImageManager.php |
| 591 | /src/Core/Domain/Shop/ValueObject/ShopId.php |
| 592 | /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php |
| 593 | /modules/mondialrelay/mondialrelay.php |
| 594 | /modules/mondialrelay/classes/MondialrelayTools.php |
| 595 | /modules/mondialrelay/classes/services/MondialrelayService.php |
| 596 | /modules/mondialrelay/classes/MondialrelayCarrierMethod.php |
| 597 | /modules/mondialrelay/classes/MondialrelaySelectedRelay.php |
| 598 | /modules/mondialrelay/vendor/totpsclasslib/src/Module.php |
| 599 | /modules/mondialrelay/translations/fr.php |
| 600 | /modules/ps_emailalerts/ps_emailalerts.php |
| 601 | /modules/ps_emailalerts/MailAlert.php |
| 602 | /src/PrestaShopBundle/Translation/DomainNormalizer.php |
| 603 | /modules/paybox/paybox.php |
| 604 | /classes/PaymentModule.php |
| 605 | /modules/paybox/src/Configuration/Settings.php |
| 606 | /modules/paybox/vendor/netresearch/jsonmapper/src/JsonMapper.php |
| 607 | /modules/paybox/src/Configuration/Account.php |
| 608 | /modules/paybox/src/Configuration/DemoAccount.php |
| 609 | /modules/paybox/src/Configuration/PaymentConfiguration.php |
| 610 | /modules/paybox/src/Configuration/SubscriptionConfiguration.php |
| 611 | /modules/paybox/src/Configuration/InstalmentConfiguration.php |
| 612 | /modules/paybox/src/Configuration/Instalment.php |
| 613 | /modules/paybox/src/Configuration/Contract.php |
| 614 | /modules/paybox/src/Utils/Tools.php |
| 615 | /vendor/monolog/monolog/src/Monolog/Logger.php |
| 616 | /vendor/monolog/monolog/src/Monolog/ResettableInterface.php |
| 617 | /vendor/monolog/monolog/src/Monolog/Handler/RotatingFileHandler.php |
| 618 | /vendor/monolog/monolog/src/Monolog/Handler/StreamHandler.php |
| 619 | /vendor/monolog/monolog/src/Monolog/Handler/AbstractProcessingHandler.php |
| 620 | /vendor/monolog/monolog/src/Monolog/Handler/AbstractHandler.php |
| 621 | /vendor/monolog/monolog/src/Monolog/Handler/HandlerInterface.php |
| 622 | /vendor/monolog/monolog/src/Monolog/Utils.php |
| 623 | /modules/paybox/translations/fr.php |
| 624 | /src/Adapter/Presenter/Cart/CartLazyArray.php |
| 625 | /src/Adapter/Presenter/AbstractLazyArray.php |
| 626 | /src/Adapter/Product/PriceFormatter.php |
| 627 | /src/Core/Util/Inflector.php |
| 628 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php |
| 629 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php |
| 630 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php |
| 631 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php |
| 632 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php |
| 633 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php |
| 634 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php |
| 635 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php |
| 636 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php |
| 637 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php |
| 638 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php |
| 639 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php |
| 640 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php |
| 641 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php |
| 642 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php |
| 643 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php |
| 644 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php |
| 645 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php |
| 646 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php |
| 647 | /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php |
| 648 | /classes/Gender.php |
| 649 | /classes/Risk.php |
| 650 | /classes/Meta.php |
| 651 | /classes/Address.php |
| 652 | /classes/State.php |
| 653 | /src/Core/Security/PasswordPolicyConfiguration.php |
| 654 | /src/Core/Configuration/DataConfigurationInterface.php |
| 655 | /classes/Media.php |
| 656 | /src/Core/Filter/FrontEndObject/MainFilter.php |
| 657 | /src/Core/Filter/FilterInterface.php |
| 658 | /src/Core/Filter/FrontEndObject/CartFilter.php |
| 659 | /src/Core/Filter/HashMapWhitelistFilter.php |
| 660 | /src/Core/Filter/CollectionFilter.php |
| 661 | /src/Core/Filter/FrontEndObject/ProductFilter.php |
| 662 | /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php |
| 663 | /src/Core/Filter/FrontEndObject/CustomerFilter.php |
| 664 | /src/Core/Filter/FrontEndObject/ShopFilter.php |
| 665 | /src/Core/Filter/FrontEndObject/ConfigurationFilter.php |
| 666 | /modules/paypal/paypal.php |
| 667 | /modules/paypal/config_prod.php |
| 668 | /src/Core/Module/WidgetInterface.php |
| 669 | /modules/paypal/classes/Shortcut/ShortcutConfiguration.php |
| 670 | /modules/paypal/smarty/plugins/modifier.paypalreplace.php |
| 671 | /modules/paypal/translations/fr.php |
| 672 | /modules/paypal/classes/Constants/PaypalConfigurations.php |
| 673 | /modules/paypal/classes/InstallmentBanner/ConfigurationMap.php |
| 674 | /modules/paypal/classes/Constants/WebHookConf.php |
| 675 | /modules/paypal/vendor/ppbtlib/src/Extensions/ProcessLogger/ProcessLoggerExtension.php |
| 676 | /modules/paypal/vendor/ppbtlib/src/Extensions/AbstractModuleExtension.php |
| 677 | /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/DiagnosticExtension.php |
| 678 | /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/Constant/DiagnosticHook.php |
| 679 | /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/StubStorage.php |
| 680 | /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Storage/DiagnosticRetriever.php |
| 681 | /modules/paypal/diagnostic.php |
| 682 | /modules/paypal/vendor/ppbtlib/src/Extensions/Diagnostic/Stubs/Model/ModuleConfigModel.php |
| 683 | /modules/paypal/classes/AbstractMethodPaypal.php |
| 684 | /modules/paypal/vendor/ppbtlib/src/AbstractMethod.php |
| 685 | /modules/paypal/classes/MethodEC.php |
| 686 | /modules/paypal/classes/WhiteList/WhiteListService.php |
| 687 | /modules/paypal/classes/API/PaypalApiManager.php |
| 688 | /modules/paypal/classes/API/PaypalApiManagerInterface.php |
| 689 | /modules/paypal/classes/API/PaypalClient.php |
| 690 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/ProductionEnvironment.php |
| 691 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalEnvironment.php |
| 692 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Environment.php |
| 693 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/PayPalHttpClient.php |
| 694 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/HttpClient.php |
| 695 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Encoder.php |
| 696 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Json.php |
| 697 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer.php |
| 698 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Text.php |
| 699 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Multipart.php |
| 700 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Serializer/Form.php |
| 701 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/AuthorizationInjector.php |
| 702 | /modules/paypal/vendor/paypal/paypalhttp/lib/PayPalHttp/Injector.php |
| 703 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/GzipInjector.php |
| 704 | /modules/paypal/vendor/paypal/paypal-checkout-sdk/lib/PayPalCheckoutSdk/Core/FPTIInstrumentationInjector.php |
| 705 | /classes/Smarty/SmartyDevTemplate.php |
| 706 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php |
| 707 | /var/cache/dev/smarty/compile/1f/b5/b4/1fb5b414db934f3cbce1f81a5328eb449f2525ce_2.module.paypalviewstemplatesfrontprefetch.tpl.php |
| 708 | /modules/iqitcontactpage/iqitcontactpage.php |
| 709 | /modules/iqitcookielaw/iqitcookielaw.php |
| 710 | /modules/iqitelementor/iqitelementor.php |
| 711 | /modules/iqitelementor/src/IqitElementorLanding.php |
| 712 | /modules/iqitelementor/src/IqitElementorTemplate.php |
| 713 | /modules/iqitelementor/src/IqitElementorProduct.php |
| 714 | /modules/iqitelementor/src/IqitElementorCategory.php |
| 715 | /modules/iqitelementor/src/IqitElementorContent.php |
| 716 | /modules/iqitelementor/src/iqitElementorWpHelper.php |
| 717 | /modules/iqitelementor/includes/plugin-elementor.php |
| 718 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php |
| 719 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php |
| 720 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php |
| 721 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php |
| 722 | /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php |
| 723 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php |
| 724 | /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php |
| 725 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php |
| 726 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php |
| 727 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php |
| 728 | /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php |
| 729 | /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php |
| 730 | /modules/iqitmegamenu/iqitmegamenu.php |
| 731 | /modules/iqitmegamenu/models/IqitMenuTab.php |
| 732 | /modules/iqitmegamenu/models/IqitMenuHtml.php |
| 733 | /modules/iqitmegamenu/models/IqitMenuLinks.php |
| 734 | /modules/iqitreviews/iqitreviews.php |
| 735 | /modules/iqitreviews/src/IqitProductReview.php |
| 736 | /src/Adapter/Localization/LegacyTranslator.php |
| 737 | /modules/iqitsizecharts/iqitsizecharts.php |
| 738 | /modules/iqitsizecharts/src/IqitSizeCharts.php |
| 739 | /modules/iqitwishlist/iqitwishlist.php |
| 740 | /modules/iqitwishlist/src/IqitWishlistProduct.php |
| 741 | /classes/assets/PrestashopAssetsLibraries.php |
| 742 | /modules/ets_htmlbox/ets_htmlbox.php |
| 743 | /modules/ets_htmlbox/classes/HBHtmlbox.php |
| 744 | /modules/ets_htmlbox/classes/HBHtmlboxPosition.php |
| 745 | /modules/ets_htmlbox/classes/Ets_htmlbox_paggination.php |
| 746 | /var/cache/dev/smarty/compile/warehouse/dc/7e/bf/dc7ebf74642731bd0b0d1cd33eb6a31eedb45e23_2.file.display-hooks.tpl.php |
| 747 | /var/cache/dev/smarty/compile/warehouse/47/97/83/4797832eb697ad3bc332b6faa37ea02ddc76d630_2.file.render-js.tpl.php |
| 748 | /modules/ps_shoppingcart/ps_shoppingcart.php |
| 749 | /modules/stripe_official/stripe_official.php |
| 750 | /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php |
| 751 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php |
| 752 | /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php |
| 753 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php |
| 754 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/All.php |
| 755 | /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Retrieve.php |
| 756 | /modules/stripe_official/translations/fr.php |
| 757 | /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php |
| 758 | /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php |
| 759 | /modules/sendinblue/sendinblue.php |
| 760 | /modules/sendinblue/translations/fr.php |
| 761 | /modules/sendinblue/services/ConfigService.php |
| 762 | /src/Core/Product/Search/ProductSearchContext.php |
| 763 | /src/Core/Product/Search/ProductSearchQuery.php |
| 764 | /src/Core/Product/Search/SortOrder.php |
| 765 | /modules/ps_facetedsearch/ps_facetedsearch.php |
| 766 | /modules/ps_facetedsearch/src/HookDispatcher.php |
| 767 | /modules/ps_facetedsearch/src/Hook/Attribute.php |
| 768 | /modules/ps_facetedsearch/src/Hook/AbstractHook.php |
| 769 | /modules/ps_facetedsearch/src/Hook/AttributeGroup.php |
| 770 | /modules/ps_facetedsearch/src/Hook/Category.php |
| 771 | /modules/ps_facetedsearch/src/Hook/Configuration.php |
| 772 | /modules/ps_facetedsearch/src/Hook/Design.php |
| 773 | /modules/ps_facetedsearch/src/Hook/Feature.php |
| 774 | /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php |
| 775 | /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php |
| 776 | /modules/ps_facetedsearch/src/Hook/FeatureValue.php |
| 777 | /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php |
| 778 | /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php |
| 779 | /modules/ps_facetedsearch/src/Hook/Product.php |
| 780 | /modules/ps_facetedsearch/src/Hook/ProductSearch.php |
| 781 | /modules/ps_facetedsearch/src/Hook/SpecificPrice.php |
| 782 | /modules/ps_facetedsearch/src/Filters/Provider.php |
| 783 | /modules/ps_facetedsearch/src/URLSerializer.php |
| 784 | /modules/ps_facetedsearch/src/Filters/DataAccessor.php |
| 785 | /modules/ps_facetedsearch/src/Product/SearchProvider.php |
| 786 | /src/Core/Product/Search/FacetsRendererInterface.php |
| 787 | /src/Core/Product/Search/ProductSearchProviderInterface.php |
| 788 | /modules/ps_facetedsearch/src/Filters/Converter.php |
| 789 | /modules/ps_facetedsearch/src/Product/SearchFactory.php |
| 790 | /src/Core/Product/Search/ProductSearchResult.php |
| 791 | /classes/Combination.php |
| 792 | /modules/ps_facetedsearch/src/Product/Search.php |
| 793 | /modules/ps_facetedsearch/src/Adapter/MySQL.php |
| 794 | /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php |
| 795 | /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php |
| 796 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php |
| 797 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php |
| 798 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php |
| 799 | /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php |
| 800 | /modules/ps_facetedsearch/src/Filters/Products.php |
| 801 | /classes/stock/StockAvailable.php |
| 802 | /modules/ps_facetedsearch/src/Filters/Block.php |
| 803 | /src/Core/Product/Search/Facet.php |
| 804 | /src/Core/Product/Search/Filter.php |
| 805 | /src/Core/Product/Search/FacetCollection.php |
| 806 | /classes/ProductAssembler.php |
| 807 | /classes/tax/Tax.php |
| 808 | /vendor/prestashop/decimal/src/DecimalNumber.php |
| 809 | /vendor/prestashop/decimal/src/Builder.php |
| 810 | /classes/Manufacturer.php |
| 811 | /classes/SpecificPrice.php |
| 812 | /classes/tax/TaxManagerFactory.php |
| 813 | /classes/tax/TaxRulesTaxManager.php |
| 814 | /classes/tax/TaxManagerInterface.php |
| 815 | /classes/tax/TaxCalculator.php |
| 816 | /classes/GroupReduction.php |
| 817 | /src/Core/Localization/CLDR/ComputingPrecision.php |
| 818 | /src/Core/Localization/CLDR/ComputingPrecisionInterface.php |
| 819 | /classes/Pack.php |
| 820 | /classes/order/Order.php |
| 821 | /classes/Feature.php |
| 822 | /src/Core/Domain/Combination/CombinationSettings.php |
| 823 | /classes/ProductPresenterFactory.php |
| 824 | /src/Adapter/Presenter/Product/ProductListingPresenter.php |
| 825 | /src/Adapter/Presenter/Product/ProductPresenter.php |
| 826 | /src/Adapter/Product/ProductColorsRetriever.php |
| 827 | /src/Adapter/HookManager.php |
| 828 | /src/Core/Product/ProductPresentationSettings.php |
| 829 | /src/Adapter/Presenter/Product/ProductListingLazyArray.php |
| 830 | /src/Adapter/Presenter/Product/ProductLazyArray.php |
| 831 | /classes/Image.php |
| 832 | /var/cache/dev/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php |
| 833 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php |
| 834 | /vendor/smarty/smarty/libs/plugins/modifier.count.php |
| 835 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php |
| 836 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php |
| 837 | /var/cache/dev/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php |
| 838 | /src/Core/Product/Search/Pagination.php |
| 839 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/a3/17/cc/a317ccf299206fe38bb426bde4cb0f8d6eb05470_2.file.category.tpl.php |
| 840 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php |
| 841 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9c/02/1a/9c021ae891eabafd6545d0e38795fddef47e24ca_2.file.product-list.tpl.php |
| 842 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/0b/42/39/0b423910144be00e8da467e91f0b0d058f7c80d1_2.file.layout-left-column.tpl.php |
| 843 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/c4/f1/6c/c4f16c922d9cb539404e91d5ce3dca291e9b7099_2.file.layout-both-columns.tpl.php |
| 844 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/a8/9d/46/a89d466a4c59d948aecc32115cb4e7e09dbe9ad4_2.file.helpers.tpl.php |
| 845 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php |
| 846 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/6b/c7/69/6bc769a5a888816e1e624cc328b29249982738e9_2.file.head.tpl.php |
| 847 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/95/63/e8/9563e81617b6d62651dd089c6d38cebd8e3cce5d_2.file.head-jsonld.tpl.php |
| 848 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/78/fa/83/78fa83b984421ceb22a66319c7509728172bef03_2.file.product-list-jsonld.tpl.php |
| 849 | /src/Core/Util/String/StringModifier.php |
| 850 | /src/Core/Util/String/StringModifierInterface.php |
| 851 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/89/ba/f9/89baf90f86f360ec3d3c8e047955e9a70e08ee73_2.file.pagination-seo.tpl.php |
| 852 | /vendor/smarty/smarty/libs/plugins/modifier.replace.php |
| 853 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/65/00/be/6500be17f5367abc80416377bee67bde5bcaf341_2.file.stylesheets.tpl.php |
| 854 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/4c/a0/0a/4ca00a5e036046fa74908edd37d0169c10794475_2.file.javascript.tpl.php |
| 855 | /classes/ProductDownload.php |
| 856 | /src/Core/Cart/Calculator.php |
| 857 | /src/Core/Cart/CartRowCollection.php |
| 858 | /src/Core/Cart/Fees.php |
| 859 | /src/Core/Cart/AmountImmutable.php |
| 860 | /src/Core/Cart/CartRuleCollection.php |
| 861 | /src/Core/Cart/CartRuleCalculator.php |
| 862 | /src/Adapter/Product/PriceCalculator.php |
| 863 | /src/Core/Cart/CartRow.php |
| 864 | /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php |
| 865 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/20/a2/cf/20a2cf03ca1a7bd93613d4d8fe9cfc0e0ba73df9_2.file.product-activation.tpl.php |
| 866 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/08/1f/11/081f111fbe1eec7005645e9bd05e10ce1f3f6932_2.file.header.tpl.php |
| 867 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b0/ae/f4/b0aef40571c00c2b7573051d3590fee3b8d2b145_2.file.social-links.tpl.php |
| 868 | /modules/ps_currencyselector/ps_currencyselector.php |
| 869 | /var/cache/dev/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php |
| 870 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9a/61/14/9a611429843acd00c5dcb2abe69ebf82dedf25a9_2.file.header-2.tpl.php |
| 871 | /modules/iqitsearch/iqitsearch.php |
| 872 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php |
| 873 | /var/cache/dev/smarty/compile/warehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php |
| 874 | /var/cache/dev/smarty/compile/warehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php |
| 875 | /modules/ps_customersignin/ps_customersignin.php |
| 876 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php |
| 877 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php |
| 878 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php |
| 879 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php |
| 880 | /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php |
| 881 | /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php |
| 882 | /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php |
| 883 | /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/8/warehouse/f0/b1/60/f0b16059a156cc89b31d04f3f5dcf0e070f02eda.iqitmegamenuviewstemplateshookhorizontal.tpl.php |
| 884 | /modules/paypal/classes/InstallmentBanner/BannerManager.php |
| 885 | /modules/paypal/classes/InstallmentBanner/Banner.php |
| 886 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/25/54/c3/2554c3e34379e9762148a66416da64892bed0820_2.file.mobile-header-1.tpl.php |
| 887 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php |
| 888 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php |
| 889 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php |
| 890 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/14/12/a2/1412a230677b6b5c7bfd8bef21d498ced4a880a7_2.file.breadcrumb.tpl.php |
| 891 | /modules/iqitproductsnav/iqitproductsnav.php |
| 892 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/2a/4f/62/2a4f629f3efb4302a8eef06388e0d24be4ef962c_2.file.notifications.tpl.php |
| 893 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/95/49/68/954968d4489257e6c441d50590555f558b7df553_2.file.category-header.tpl.php |
| 894 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/10/91/fe/1091fed513d122e0504979a64a71b168ad630787_2.file.products-top.tpl.php |
| 895 | /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php |
| 896 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/66/06/00/6606000620ee7efa4d2cf12765ee73691001edc8_2.file.sort-orders.tpl.php |
| 897 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/21/d4/ba/21d4ba532e587545c2b163557d0a40bfb02228f4_2.file.products.tpl.php |
| 898 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/84/c0/19/84c019b3eb6cea28a3550a5f1e013053d90a03d7_2.file.product.tpl.php |
| 899 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/fb/c4/16/fbc416687dd9039916ce15882bbe13d32336e836_2.file.product-miniature-1.tpl.php |
| 900 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/e8/c4/ed/e8c4edeaf8edbdcb9cf3d0e9481101b1b2c63b5c_2.file.product-miniature-thumb.tpl.php |
| 901 | /var/cache/dev/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php |
| 902 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/67/a7/d7/67a7d7658962713e22e4a67918b9d9d107cae1b6_2.file.product-miniature-btn.tpl.php |
| 903 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/9e/44/72/9e44726f8196c8e2d6bff08d99367a7d351ad105_2.file.pagination.tpl.php |
| 904 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/0d/2c/05/0d2c050be73f28bab40041baf2d8164ef32e750b_2.file.products-bottom.tpl.php |
| 905 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/13/20/99/132099701fe408d3d797b6a8bf6f33aa7ef97cfe_2.file.category-footer.tpl.php |
| 906 | /modules/ps_categorytree/ps_categorytree.php |
| 907 | /var/cache/dev/smarty/compile/warehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php |
| 908 | /var/cache/dev/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php |
| 909 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/72/3b/bd/723bbd621a29460272d686cf4934ee05e08771bf_2.file.footer.tpl.php |
| 910 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/1d/37/95/1d37957b5d23da0294e6b34ce9ac436bf3fd3f41_2.file.footer-1.tpl.php |
| 911 | /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/8/warehouse/e2/3a/ce/e23ace2a0f321499ee72e308b83defc668cd699f.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php |
| 912 | /modules/ps_emailsubscription/ps_emailsubscription.php |
| 913 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/96/e2/7e/96e27e76e9dfa37b84c4d6819e82f4519347e8f0_2.file.footer-copyrights-1.tpl.php |
| 914 | /var/cache/dev/smarty/compile/warehouselayouts_layout_left_column_tpl/03/a8/a4/03a8a45abe7862b466291c6d486512460867ac39_2.file.password-policy-template.tpl.php |
| 915 | /classes/form/CustomerLoginForm.php |
| 916 | /classes/form/AbstractForm.php |
| 917 | /classes/form/FormInterface.php |
| 918 | /src/Core/Foundation/Templating/RenderableInterface.php |
| 919 | /classes/form/CustomerLoginFormatter.php |
| 920 | /classes/form/FormFormatterInterface.php |
| 921 | /classes/ValidateConstraintTranslator.php |
| 922 | /src/Core/Util/InternationalizedDomainNameConverter.php |
| 923 | /src/Core/Foundation/Templating/RenderableProxy.php |
| 924 | /var/cache/dev/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php |
| 925 | /classes/form/FormField.php |
| 926 | /var/cache/dev/smarty/compile/warehouse/e0/5f/b7/e05fb775e4b6090f9853573d39020f71f9dbf971_2.file.login-form.tpl.php |
| 927 | /var/cache/dev/smarty/compile/warehouse/25/80/31/258031b7f39ee9647ae9662d2530b446cdb9f168_2.file.form-errors.tpl.php |
| 928 | /var/cache/dev/smarty/compile/fc/79/dc/fc79dcb8048a5023d0599d56c7de793f2c678d56_2.file.form-fields.tpl.php |
| 929 | /var/cache/dev/smarty/compile/25/80/31/258031b7f39ee9647ae9662d2530b446cdb9f168_2.file.form-errors.tpl.php |
| 930 | /var/cache/dev/smarty/cache/iqitcookielaw/1/1/1/8/warehouse/71/d9/e8/71d9e8105eeffb58554d3061ba6c84c133b40b34.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php |
| 931 | /modules/statsdata/statsdata.php |
| 932 | /classes/Connection.php |
| 933 | /classes/ConnectionsSource.php |
